Hippocalcin (HPCA) (NM_002143) Human Tagged ORF Clone

CAT#: RC200511

HPCA (Myc-DDK-tagged)-Human hippocalcin (HPCA)

Product Images

Circular map for RC200511

• 

  Western blot validation of overexpression lysate (Cat# LY419505) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200511 using transfection reagent MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Hippocalcin
• Synonyms: BDR2; DYT2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200511 representing NM_002143
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGCAAGCAGAACAGCAAGCTGCGGCCCGAGATGTTGCAGGACCTGCGAGAGAACACAGAGTTCTCAG
  AGCTGGAGCTGCAGGAGTGGTACAAGGGCTTCCTCAAGGACTGCCCCACAGGAATCCTCAATGTGGATGA
  GTTCAAGAAGATCTACGCCAACTTCTTTCCCTATGGTGACGCCTCCAAGTTTGCCGAGCACGTCTTCCGC
  ACCTTTGACACCAACAGCGATGGCACCATAGACTTTCGGGAGTTCATCATTGCGCTGAGCGTGACCTCGC
  GCGGCCGCCTGGAGCAGAAGCTCATGTGGGCCTTCAGCATGTATGACCTGGACGGCAACGGCTACATCAG
  CCGGGAGGAGATGCTGGAGATCGTGCAGGCCATTTACAAGATGGTTTCGTCCGTGATGAAGATGCCGGAG
  GACGAGTCGACCCCGGAAAAGAGGACTGAGAAAATCTTCCGCCAAATGGACACAAACAACGACGGCAAGC
  TGTCCTTGGAGGAGTTCATCCGCGGGGCCAAAAGCGACCCGTCCATCGTGCGTCTGCTGCAGTGCGACCC
  CAGCAGCGCCTCCCAGTTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200511 representing NM_002143
  Red=Cloning site Green=Tags(s)
  
  MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFR
  TFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPE
  DESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_002143
• ORF Size: 579 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_002143.3
• RefSeq Size: 1440 bp
• RefSeq ORF: 582 bp
• Locus ID: 3208
• UniProt ID: P84074
• Cytogenetics: 1p35.1
• Domains: EFh
• MW: 22.2 kDa
• Gene Summary: The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. This protein is associated with the plasma membrane. It has similarities to proteins located in the photoreceptor cells that regulate photosignal transduction in a calcium-sensitive manner. This protein displays recoverin activity and a calcium-dependent inhibition of rhodopsin kinase. It is identical to the rat and mouse hippocalcin proteins and thought to play an important role in neurons of the central nervous system in a number of species. [provided by RefSeq, Jul 2008]