PHF5A (NM_032758) Human Tagged ORF Clone
CAT#: RC200284
PHF5A (Myc-DDK-tagged)-Human PHD finger protein 5A (PHF5A)
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_032758" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | PHF5A |
Synonyms | bK223H9.2; INI; Rds3; SAP14b; SF3B7; SF3b14b |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200284 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTAAACATCATCCTGATTTGATCTTTTGCCGCAAGCAGGCTGGTGTTGCCATCGGAAGACTGTGTG AAAAATGTGATGGCAAGTGTGTGATTTGTGACTCCTATGTGCGTCCCTGCACTCTGGTGCGCATATGTGA TGAGTGTAACTATGGATCTTACCAGGGGCGCTGTGTGATCTGTGGAGGACCTGGGGTCTCTGATGCCTAT TATTGTAAGGAGTGCACCATCCAGGAGAAGGACAGAGATGGCTGCCCAAAGATTGTCAATCTGGGGAGCT CTAAGACAGACCTCTTCTATGAACGCAAAAAATACGGCTTCAAGAAGAGG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200284 protein sequence
Red=Cloning site Green=Tags(s) MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAY YCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_032758 |
ORF Size | 330 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_032758.4 |
RefSeq Size | 1105 bp |
RefSeq ORF | 333 bp |
Locus ID | 84844 |
UniProt ID | Q7RTV0 |
Cytogenetics | 22q13.2 |
Protein Families | Transcription Factors |
Protein Pathways | Spliceosome |
MW | 12.4 kDa |
Gene Summary | This gene encodes a subunit of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. The protein encoded by this gene contains a PHD-finger-like domain that is flanked by highly basic N- and C-termini. This protein belongs to the PHD-finger superfamily and may act as a chromatin-associated protein. This gene has several pseudogenes on different chromosomes. [provided by RefSeq, Jul 2008] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200284L1 | Lenti ORF clone of Human PHD finger protein 5A (PHF5A), Myc-DDK-tagged |
USD 450.00 |
|
RC200284L2 | Lenti ORF clone of Human PHD finger protein 5A (PHF5A), mGFP tagged |
USD 450.00 |
|
RC200284L3 | Lenti ORF clone of Human PHD finger protein 5A (PHF5A), Myc-DDK-tagged |
USD 450.00 |
|
RC200284L4 | Lenti ORF clone of Human PHD finger protein 5A (PHF5A), mGFP tagged |
USD 450.00 |
|
RG200284 | PHF5A (tGFP-tagged) - Human PHD finger protein 5A (PHF5A) |
USD 350.00 |
|
SC123060 | PHF5A (untagged)-Human PHD finger protein 5A (PHF5A) |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review