CRABP2 (NM_001878) Human Tagged ORF Clone
CAT#: RC200221
CRABP2 (Myc-DDK-tagged)-Human cellular retinoic acid binding protein 2 (CRABP2), transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro
AAV Particle: DDK
"NM_001878" in other vectors (6)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | CRABP2 |
Synonyms | CRABP-II; RBP6 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200221 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCAACTTCTCTGGCAACTGGAAAATCATCCGATCGGAAAACTTCGAGGAATTGCTCAAAGTGCTGG GGGTGAATGTGATGCTGAGGAAGATTGCTGTGGCTGCAGCGTCCAAGCCAGCAGTGGAGATCAAACAGGA GGGAGACACTTTCTACATCAAAACCTCCACCACCGTGCGCACCACAGAGATTAACTTCAAGGTTGGGGAG GAGTTTGAGGAGCAGACTGTGGATGGGAGGCCCTGTAAGAGCCTGGTGAAATGGGAGAGTGAGAATAAAA TGGTCTGTGAGCAGAAGCTCCTGAAGGGAGAGGGCCCCAAGACCTCGTGGACCAGAGAACTGACCAACGA TGGGGAACTGATCCTGACCATGACGGCGGATGACGTTGTGTGCACCAGGGTCTACGTCCGAGAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200221 protein sequence
Red=Cloning site Green=Tags(s) MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGE EFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_001878 |
ORF Size | 414 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_001878.4 |
RefSeq Size | 1088 bp |
RefSeq ORF | 417 bp |
Locus ID | 1382 |
UniProt ID | P29373 |
Cytogenetics | 1q23.1 |
Domains | lipocalin |
Protein Families | Druggable Genome, Transcription Factors |
MW | 15.7 kDa |
Gene Summary | This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate receptor complex and transfer to the nucleus. It is involved in the retinoid signaling pathway, and is associated with increased circulating low-density lipoprotein cholesterol. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2010] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200221L1 | Lenti ORF clone of Human cellular retinoic acid binding protein 2 (CRABP2), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC200221L2 | Lenti ORF clone of Human cellular retinoic acid binding protein 2 (CRABP2), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RC200221L3 | Lenti ORF clone of Human cellular retinoic acid binding protein 2 (CRABP2), transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC200221L4 | Lenti ORF clone of Human cellular retinoic acid binding protein 2 (CRABP2), transcript variant 1, mGFP tagged |
USD 450.00 |
|
RG200221 | CRABP2 (tGFP-tagged) - Human cellular retinoic acid binding protein 2 (CRABP2), transcript variant 1 |
USD 350.00 |
|
SC119002 | CRABP2 (untagged)-Human cellular retinoic acid binding protein 2 (CRABP2), transcript variant 1 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review