THUMPD3 (NM_015453) Human Tagged ORF Clone

CAT#: RC200121

Reviews ()
Write a review

THUMPD3 (Myc-DDK-tagged)-Human THUMP domain containing 3 (THUMPD3), transcript variant 1



  "NM_015453" in other vectors (4)

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name THUMPD3 (NM_015453) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol THUMPD3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200121 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGACATTGAAGAAGCCACTAACCAACTCCTAGATGTGAACCTTCATGAGAACCAGAAGTCTGTAC
AAGTGACAGAAAGCGACCTCGGAAGTGAATCTGAGCTTCTAGTCACTATTGGAGCCACTGTACCTACTGG
CTTTGAGCAAACAGCTGCAGATGAAGTCAGAGAGAAACTTGGGTCATCATGCAAAATCAGCAGAGACCGT
GGCAAGATATATTTTGTCATTTCAGTGGAAAGTCTGGCACAGGTTCATTGTCTGAGATCAGTTGATAACT
TATTTGTGGTGGTTCAGGAGTTTCAAGATTACCAGTTCAAACAAACAAAGGAAGAAGTTCTAAAGGATTT
TGAAGACTTGGCTGGAAAACTCCCATGGTCAAACCCCTTAAAAGTGTGGAAAATTAATGCCAGTTTTAAA
AAGAAAAAAGCAAAGCGCAAAAAGATAAATCAGAATTCAAGTAAAGAGAAGATTAATAATGGACAAGAAG
TCAAAATCGATCAGAGAAATGTTAAAAAAGAGTTCACTAGCCATGCTTTAGATTCTCATATCTTAGATTA
TTATGAAAATCCAGCCATCAAAGAGGATGTATCAACATTAATAGGTGATGATTTGGCATCTTGCAAAGAT
GAGACTGATGAAAGCTCAAAAGAAGAAACTGAGCCTCAAGTGCTGAAGTTTAGAGTCACATGCAACAGGG
CAGGAGAGAAACATTGCTTTACCTCAAATGAGGCTGCAAGAGATTTTGGGGGTGCTGTTCAAGATTATTT
TAAGTGGAAGGCCGACATGACCAACTTTGATGTGGAGGTTCTTTTGAACATCCATGATAATGAAGTCATT
GTGGGCATTGCATTGACTGAAGAGAGTCTCCACCGAAGAAATATAACACATTTTGGACCTACAACTCTTA
GATCAACTCTTGCCTATGGGATGCTCAGGCTCTGTGATCCTCTACCTTATGATATAATAGTCGATCCAAT
GTGTGGAACTGGGGCAATACCAATAGAGGGGGCCACTGAATGGTCTGACTGCTTCCATATTGCTGGTGAT
AATAATCCACTGGCTGTGAATAGAGCAGCAAATAACATTGCATCTTTATTGACCAAGAGCCAAATTAAAG
AAGGCAAACCCTCCTGGGGCTTGCCCATAGATGCTGTTCAGTGGGATATCTGCAATCTGCCATTGAGAAC
TGGCTCTGTGGATATTATTGTAACAGATTTGCCATTTGGAAAAAGGATGGGATCCAAGAAAAGAAACTGG
AACCTTTATCCAGCTTGCCTACGGGAGATGAGCCGTGTCTGCACACCTACCACAGGCCGAGCTGTACTAC
TTACTCAAGACACAAAATGCTTTACCAAGGCGTTATCTGGAATGCGACACGTATGGCGAAAGGTGGATAC
AGTCTGGGTGAACGTTGGTGGTCTTCGTGCTGCAGTTTACGTTCTGATACGTACACCTCAAGCTTTTGTT
CATCCTTCAGAACAAGACGGAGAAAGAGGAACTCTTTGGCAATGCAAAGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200121 protein sequence
Red=Cloning site Green=Tags(s)

MCDIEEATNQLLDVNLHENQKSVQVTESDLGSESELLVTIGATVPTGFEQTAADEVREKLGSSCKISRDR
GKIYFVISVESLAQVHCLRSVDNLFVVVQEFQDYQFKQTKEEVLKDFEDLAGKLPWSNPLKVWKINASFK
KKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHALDSHILDYYENPAIKEDVSTLIGDDLASCKD
ETDESSKEETEPQVLKFRVTCNRAGEKHCFTSNEAARDFGGAVQDYFKWKADMTNFDVEVLLNIHDNEVI
VGIALTEESLHRRNITHFGPTTLRSTLAYGMLRLCDPLPYDIIVDPMCGTGAIPIEGATEWSDCFHIAGD
NNPLAVNRAANNIASLLTKSQIKEGKPSWGLPIDAVQWDICNLPLRTGSVDIIVTDLPFGKRMGSKKRNW
NLYPACLREMSRVCTPTTGRAVLLTQDTKCFTKALSGMRHVWRKVDTVWVNVGGLRAAVYVLIRTPQAFV
HPSEQDGERGTLWQCKE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015453
ORF Size 1521 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015453.3
RefSeq Size 3980 bp
RefSeq ORF 1524 bp
Locus ID 25917
Cytogenetics 3p25.3
Domains UPF0020, THUMP
MW 57 kDa

Other Versions

Other products for "THUMPD3"
Frequently bought together (3)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-THUMPD3 Antibody
    • 100 ul

USD 360.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools