IDH3B (NM_006899) Human Tagged ORF Clone

CAT#: RC200108

  • TrueORF®

IDH3B (Myc-DDK-tagged)-Human isocitrate dehydrogenase 3 (NAD+) beta (IDH3B), nuclear gene encoding mitochondrial protein, transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_006899" in other vectors (4)

Reconstitution Protocol

USD 732.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-IDH3B Antibody
    • 100 ul

USD 380.00

Other products for "IDH3B"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol IDH3B
Synonyms RP46
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200108 representing NM_006899
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCATTGAGCGGAGTCCGCTGGCTGACCCGAGCGCTGGTCTCCGCCGGGAACCCTGGGGCATGGA
GAGGTCTGAGTACCTCGGCCGCGGCGCACGCTGCATCGCGGAGCCAGGCCGAGGACGTGAGGGTGGAGGG
CTCCTTTCCCGTGACCATGCTTCCGGGAGACGGTGTGGGGCCTGAGCTGATGCACGCCGTCAAGGAGGTG
TTCAAGGCTGCCGCTGTCCCAGTGGAGTTCCAGGAGCACCACCTGAGTGAGGTGCAGAATATGGCATCTG
AGGAGAAGCTGGAGCAGGTGCTGAGTTCCATGAAGGAGAACAAAGTGGCCATCATTGGAAAGATTCATAC
CCCGATGGAGTATAAGGGGGAGCTAGCCTCCTATGATATGCGGCTGAGGCGTAAGTTGGACTTATTTGCC
AACGTAGTCCATGTGAAGTCACTTCCTGGGTATATGACTCGGCACAACAATCTAGACCTGGTGATCATTC
GAGAGCAGACAGAAGGGGAGTACAGCTCTCTGGAACATGAGAGTGCAAGGGGTGTGATTGAGTGTTTGAA
GATTGTCACACGAGCCAAGTCTCAGCGGATTGCAAAGTTCGCCTTTGACTATGCCACCAAGAAGGGGCGG
GGCAAGGTCACTGCTGTCCACAAGGCCAACATCATGAAACTTGGGGATGGGTTGTTCCTGCAGTGCTGTG
AGGAAGTTGCTGAACTGTACCCCAAAATCAAATTTGAGACAATGATCATAGACAACTGCTGCATGCAGCT
GGTGCAGAATCCTTACCAGTTTGATGTGCTTGTGATGCCCAATCTCTATGGGAACATTATTGACAATCTG
GCTGCTGGCCTGGTTGGGGGAGCTGGTGTGGTCCCTGGTGAGAGCTATAGTGCAGAATACGCAGTCTTTG
AGACGGGTGCCCGGCACCCATTTGCCCAGGCAGTGGGCAGGAATATAGCCAATCCCACGGCCATGCTGCT
GTCGGCTTCCAACATGCTGCGGCATCTTAATCTTGAGTATCACTCCAGCATGATCGCAGATGCGGTGAAG
AAGGTGATCAAAGTTGGCAAGGTGCGGACTCGAGACATGGGCGGCTACAGCACCACAACCGACTTCATCA
AGTCTGTCATCGGTCACCTGCAGACTAAAGGGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200108 representing NM_006899
Red=Cloning site Green=Tags(s)

MAALSGVRWLTRALVSAGNPGAWRGLSTSAAAHAASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEV
FKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFA
NVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGR
GKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNL
AAGLVGGAGVVPGESYSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVK
KVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006899
ORF Size 1155 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006899.5
RefSeq Size 1561 bp
RefSeq ORF 1158 bp
Locus ID 3420
UniProt ID O43837
Cytogenetics 20p13
Domains isodh
Protein Pathways Citrate cycle (TCA cycle), Metabolic pathways
MW 42.2 kDa
Gene Summary Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Sep 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.