Btrc (NM_001286466) Mouse Tagged ORF Clone

CAT#: MR229625

  • TrueORF®

Btrc (myc-DDK-tagged) - Mouse beta-transducin repeat containing protein (Btrc), transcript variant 4


  "NM_001286466" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 503.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Btrc Antibody - C-terminal region
    • 100 ul

USD 539.00

Other products for "Btrc"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Btrc
Synonyms b-TrCP; beta-TrCP; Beta-Trcp1; E3RS-IkappaB; E3RSIkappaB; Fbw1a; FWD1; HOS; Slimb
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR229625 representing NM_001286466
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTGGAAAAAGCTCATCGAGAGGATGGTCAGGACGGACTCTCTGTGGCGAGGCCTGGCAGAGCGCA
GAGGCTGGGGACAGTACTTATTCAAAAACAAACCTCCTGATGAGAACGCTCCTCCCAACTCCTTTTATAG
AGCGCTTTATCCTAAAATCATACAAGACATTGAGACAATAGAGTCCAATTGGAGATGTGGGCGACATAGT
TTACAGAGAATCCACTGCCGGAGTGAAACAAGTAAAGGGGTTTACTGTTTACAGTACGACGACCAGAAGA
TAGTCAGCGGCCTTCGAGACAACACCATCAAGATCTGGGATAAAAGCACACTGGAATGCAAGCGGATTCT
CACGGGCCACACGGGCTCCGTCCTGTGTCTGCAGTACGATGAGAGGGTGATCATCACAGGCTCCTCAGAC
TCCACCGTCAGAGTGTGGGATGTAAATGCAGGTGAGATGCTAAACACATTGATTCACCACTGTGAAGCCG
TTCTGCACCTGCGCTTCAATAATGGCATGATGGTGACCTGTTCCAAAGACCGTTCCATCGCTGTGTGGGA
TATGGCTTCCCCAACTGACATCACCCTCAGGAGGGTGCTGGTGGGACACCGAGCTGCGGTCAATGTTGTA
GACTTTGATGACAAGTACATCGTTTCTGCCTCTGGAGATAGAACCATAAAGGTGTGGAACACAAGTACCT
GTGAATTCGTAAGGACCCTAAATGGGCACAAGCGTGGCATCGCCTGTTTGCAGTACAGAGACAGGCTGGT
GGTGAGCGGCTCCTCTGACAACACCATCAGGCTGTGGGACATAGAGTGTGGAGCATGCCTGCGAGTGTTG
GAGGGCCATGAGGAGTTGGTACGCTGCATTCGATTTGATAACAAAAGGATAGTGAGCGGAGCCTATGATG
GGAAAATTAAAGTGTGGGATCTTATGGCTGCTTTGGACCCGCGTGCTCCAGCAGGGACTCTCTGTCTGCG
GACACTTGTGGAGCATTCTGGAAGAGTTTTCCGCCTCCAGTTTGATGAATTCCAGATTGTCAGTAGTTCA
CATGATGACACAATTCTCATCTGGGACTTCCTGAATGATCCAGCTGCTCACGCTGAACCGCCCCGCTCCC
CTTCTCGGACATACACCTACATCTCCAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR229625 representing NM_001286466
Red=Cloning site Green=Tags(s)

MLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDENAPPNSFYRALYPKIIQDIETIESNWRCGRHS
LQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGSSD
STVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVV
DFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVL
EGHEELVRCIRFDNKRIVSGAYDGKIKVWDLMAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSS
HDDTILIWDFLNDPAAHAEPPRSPSRTYTYISR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001286466
ORF Size 1149 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001286466.1, NP_001273395.1
RefSeq Size 6126 bp
RefSeq ORF 1152 bp
Locus ID 12234
UniProt ID Q3ULA2
Cytogenetics 19 C3
MW 44.4 kDa
Gene Summary Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes and binds to phosphorylated target proteins (PubMed:10097128, PubMed:16371461, PubMed:18782782, PubMed:9859996, PubMed:9990853, PubMed:21911472). SCF(BTRC) mediates the ubiquitination of phosphorylated NFKB, ATF4, CDC25A, DLG1, FBXO5, PER1, SMAD3, SMAD4, SNAI1 and probably NFKB2. SCF(BTRC) mediates the ubiquitination of CTNNB1 and participates in Wnt signaling (By similarity). SCF(BTRC) mediates the ubiquitination of NFKBIA, NFKBIB and NFKBIE; the degradation frees the associated NFKB1 to translocate into the nucleus and to activate transcription (PubMed:9859996, PubMed:10097128). Ubiquitination of NFKBIA occurs at 'Lys-21' and 'Lys-22' (PubMed:9859996, PubMed:10097128). SCF(BTRC) mediates the ubiquitination of CEP68; this is required for centriole separation during mitosis (By similarity). SCF(BTRC) mediates the ubiquitination and subsequent degradation of nuclear NFE2L1 (PubMed:21911472). Has an essential role in the control of the clock-dependent transcription via degradation of phosphorylated PER1 and PER2 (PubMed:18782782). May be involved in ubiquitination and subsequent proteasomal degradation through a DBB1-CUL4 E3 ubiquitin-protein ligase (By similarity). Required for activation of NFKB-mediated transcription by IL1B, MAP3K14, MAP3K1, IKBKB and TNF (By similarity). Required for proteolytic processing of GLI3 (PubMed:16371461). Mediates ubiquitination of REST, thereby leading to its proteasomal degradation (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.