Fut1 (NM_001271981) Mouse Tagged ORF Clone

CAT#: MR229238

  • TrueORF®

Fut1 (myc-DDK-tagged) - Mouse fucosyltransferase 1 (Fut1), transcript variant 2


  "NM_001271981" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 330.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


FUT1 Antibody - C-terminal region
    • 100 ul

USD 539.00

Other products for "Fut1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Fut1
Synonyms MFUT-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR229238 representing NM_001271981
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTATGCCTACCTCATCCATTGCAGACATCTAATGGCTCCCCTTCCTGTCCTGAGCAGTCCTCCTCAC
TCTCTGGGACTTGGACAATCACCCCAGGAGGCAGGTTTGGTAACCAGATGGGGCAGTATGCTACATTGCT
GGCCCTAGCCCAGCTCAATGGTCGCCAAGCCTTCATCCAACCTGAGATGCATGCCGCCCTGGCCCCCGTG
TTCCGAATCTCCCTGCCAGTGCTGGACCCTGAGGTGGACAGCCTCACACCTTGGCAGCACTTAGTCCTAC
ATGACTGGATGTCAGAGGAGTACTCCCATCTGGAGGACCCATTTCTCAAGCTGTCTGGTTTCCCCTGCTC
TTGGACCTTTTTCCATCATCTTCGGGAACAGATTCGTAGGGAATTCACTCTGCATAACCATCTACGGGAA
GGTGCCCAGTACCTGTTGAGCGGGCTCCGTATAGGCCCGGCGGGCATCCGCCCTCATACCTTTGTGGGTG
TCCATGTGCGTCGTGGAGACTATCTGGAGGTGATGCCCAATCGCTGGAAGGGTGTGGTGGGTGACCGAGC
TTACCTCCAGCAAGCCATGGACTGGTTCCGGGCCCGACACAAAGACCCCATCTTTGTGGTCACCAGCAAT
GGCATGAAATGGTGTTTGGAGAACATTGACACATCCCATGGTGATGTGGTCTTCGCTGGCAATGGACAGG
AGGGTACACCGGGGAAGGACTTTGCACTTCTCACACAGTGTAACCACACCATCATGACTATTGGCACCTT
TGGCTTCTGGGCTGCCTACTTAGCTGGTGGAGACACGGTCTACCTTGCAAACTTCACCCTGCCAGATTCG
GAGTTTCTGAAGATCTTCAGGCCTGAGGCTGCCTTCCTGCCTGAGTGGGTGGGCATCAATGCAGACTTGT
CCCCGCTGCAGGCTCAATTTGACCCCTGGAAGCCAGACAGTCTTTTTAGATTGGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR229238 representing NM_001271981
Red=Cloning site Green=Tags(s)

MVCLPHPLQTSNGSPSCPEQSSSLSGTWTITPGGRFGNQMGQYATLLALAQLNGRQAFIQPEMHAALAPV
FRISLPVLDPEVDSLTPWQHLVLHDWMSEEYSHLEDPFLKLSGFPCSWTFFHHLREQIRREFTLHNHLRE
GAQYLLSGLRIGPAGIRPHTFVGVHVRRGDYLEVMPNRWKGVVGDRAYLQQAMDWFRARHKDPIFVVTSN
GMKWCLENIDTSHGDVVFAGNGQEGTPGKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDS
EFLKIFRPEAAFLPEWVGINADLSPLQAQFDPWKPDSLFRLV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001271981
ORF Size 966 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001271981.1, NP_001258910.1
RefSeq Size 2442 bp
RefSeq ORF 969 bp
Locus ID 14343
UniProt ID O09160
Cytogenetics 7 29.39 cM
MW 36.7 kDa
Gene Summary This gene is one of three genes in mouse which encode a galactoside 2-L-fucosyltransferase. These genes differ in their developmental- and tissue-specific expression. The encoded type II membrane protein is anchored in the Golgi apparatus and controls the final step in the creation of alpha (1,2) fucosylated carbhohydrates by the addition of a terminal fucose in an alpha (1,2) linkage. This enzyme is required for the synthesis of the Lewis antigen as well as the H-antigen, a precursor of the A and B antigens of the ABH histo-blood group. The biological function of the fucosylated carbhohydrate products is thought to involve cell-adhesion and interactions with microorganisms. Disruption of this gene impairs development of the olfactory nerve and maturation of the glomerular layer of the main olfactory bulb. Alternative splicing results in multiple transcript variants which encode distinct isoforms. [provided by RefSeq, Dec 2012]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.