Pqbp1 (NM_001252529) Mouse Tagged ORF Clone

CAT#: MR229063

Pqbp1 (myc-DDK-tagged) - Mouse polyglutamine binding protein 1 (Pqbp1), transcript variant 3

Product Images

Circular map for MR229063

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Pqbp1
• Synonyms: npw38; PQBP-1; Sfc2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR229063 representing NM_001252529
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCGACCAGTTAATTGCACCTGGGGAGAGTCGAGGAGCCTGTTGTGCTTTAAACCAAGAGCCCTTCGGT
  GTTGGTCTGGTCAGCTACCCACTATGCCGCTTCCTGTTGCGCTGCAGACCCGCTTGGCGAAGAGGGGCAT
  CCTCAAACATCTGGAGCCGGAGCCAGAGGAAGAGATTATTGCTGAAGACTACGATGATGATCCTGTTGAC
  TATGAGGCCACCCGGATAGAGGGTCTGCCACCGAGCTGGTACAAGGTGTTTGACCCTTCTTGCGGACTCC
  CTTACTATTGGAATGTGGAGACAGACCTTGTGTCGTGGCTCTCACCACATGATCCTAACTTTGTCGTTAC
  CAAATCCGCCAAGAAAGTCAGGAACAATAATGCAGATGCTGAGGACAAGTCGGACCGGAATCTTGAAAAG
  GTGGACAGAAATCATGAGAAGTCAGATCGTAGTCATGAGAAGCCAGACAGGAGCCACGAGAAGGCAGACC
  GAAACCACGAGAAGAATGACAGAGAACGAGAGCGCAACTACGACAAAGTGGATAGAGAGAGAGATCGGGA
  CAGGGAACGAGAGCGGGCATTTGACAAGGCAGACCGGGAAGAGGGCAAAGACCGACGCCACCATCGCAGA
  GAGGAACTGGCTCCTTACCCCAAGAACAAGAAAGCGACGAGCCGCAAAGATGAAGAATTAGACCCCATGG
  ACCCCAGCTCATACTCAGATGCACCCCGGGGCACATGGTCAACAGGACTCCCCAAGAGGAACGAGGCCAA
  GACAGGTGCTGACACCACGGCAGCTGGGCCCCTCTTCCAGCAGCGCCCTTACCCTTCCCCGGGCGCTGTG
  CTCCGCGCCAATGCAGAAGCCTCCCGAACCAAACAGCAGGAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR229063 representing NM_001252529
  Red=Cloning site Green=Tags(s)
  
  MRPVNCTWGESRSLLCFKPRALRCWSGQLPTMPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVD
  YEATRIEGLPPSWYKVFDPSCGLPYYWNVETDLVSWLSPHDPNFVVTKSAKKVRNNNADAEDKSDRNLEK
  VDRNHEKSDRSHEKPDRSHEKADRNHEKNDRERERNYDKVDRERDRDRERERAFDKADREEGKDRRHHRR
  EELAPYPKNKKATSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAV
  LRANAEASRTKQQD
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001252529
• ORF Size: 882 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001252529.1, NP_001239458.1
• RefSeq Size: 1119 bp
• RefSeq ORF: 885 bp
• Locus ID: 54633
• UniProt ID: Q91VJ5
• Cytogenetics: X 3.56 cM
• MW: 34.6 kDa
• Gene Summary: Intrinsically disordered protein that acts as a scaffold, and which is involved in different processes, such as pre-mRNA splicing, transcription regulation, innate immunity and neuron development (By similarity). Interacts with splicing-related factors via the intrinsically disordered region and regulates alternative splicing of target pre-mRNA species (PubMed:23512658). May suppress the ability of POU3F2 to transactivate the DRD1 gene in a POU3F2 dependent manner (By similarity). Can activate transcription directly or via association with the transcription machinery (By similarity). May be involved in ATXN1 mutant-induced cell death (By similarity). The interaction with ATXN1 mutant reduces levels of phosphorylated RNA polymerase II large subunit (By similarity). Involved in the assembly of cytoplasmic stress granule, possibly by participating to the transport of neuronal RNA granules (By similarity). Also acts as an innate immune sensor of infection by retroviruses, by detecting the presence of reverse-transcribed DNA in the cytosol (By similarity). Directly binds retroviral reverse-transcribed DNA in the cytosol and interacts with CGAS, leading to activate the cGAS-STING signaling pathway, triggering type-I interferon production (By similarity).[UniProtKB/Swiss-Prot Function]