Pphln1 (NM_001285864) Mouse Tagged ORF Clone

CAT#: MR228759

Pphln1 (myc-DDK-tagged) - Mouse periphilin 1 (Pphln1), transcript variant 5

Product Images

Circular map for MR228759

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Pphln1
• Synonyms: CR; HSPC206; HSPC232
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR228759 representing NM_001285864
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAGAGACGGCTTCAGAAGAAAGAGTTTCTACTCTTCACATTATTCGAGAGATCGGTCTCCCCATAAAA
  GGGACGCTCCCTTCTTCAGAGAATCCCCTGTCGGCCGGAAGGACTCCCCACACAGCAGATCCGGCTCCAG
  TGTCAGCAGCAGAAGCTATTCTCCAGAGCGAAGCAGGACTCACTCCTTCCATCAGTCTCAGCATAGAAGT
  AAAGAGAGATCCATCCAGTCAGTGAAAACCTCGAGAGATGCGTCACCCTCAAGTTCCTCAGCAGTTGCTT
  CATCCAAGGCGTTAGACAAACCCAGCAGGCTAACTGAGAAGGAACTTGCTGAGGCTGAAAGCAAGTGGGC
  TAATGAAACACTAGAGAAGTCAGACGAAAGTAACTTGGCTGAAATGAATGAGTTTGAGGCGGGATCCACG
  GCACCCTTATTTATTGACCAGACAGAAGAACCCGAGTCAAACACAGTAGATGGTACAGAACTGTATGAAG
  ACAGCCAGCTCAGCAACCGCTCTAAAGCCATTGCCTCGAAAACCAAAGAGATTGAGCAGGTTTACCGACA
  AGACTGCGAGACTTTCGGGATGGTGGTGAAAATGCTGATTGAAAAAGATCCCTCATTAGAAAAGTCTGTC
  CAGTTTGCACTGAGGCAGAACTTACACGAGATAGGTGAGCGCTGCGTGGAAGAGCTCAAGCGTTTCATTA
  CTGAGTATGACAACTCTGCTCAGGACTTTGGAGACCCCTTT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR228759 representing NM_001285864
  Red=Cloning site Green=Tags(s)
  
  MRDGFRRKSFYSSHYSRDRSPHKRDAPFFRESPVGRKDSPHSRSGSSVSSRSYSPERSRTHSFHQSQHRS
  KERSIQSVKTSRDASPSSSSAVASSKALDKPSRLTEKELAEAESKWANETLEKSDESNLAEMNEFEAGST
  APLFIDQTEEPESNTVDGTELYEDSQLSNRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSV
  QFALRQNLHEIGERCVEELKRFITEYDNSAQDFGDPF
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001285864
• ORF Size: 741 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001285864.1, NP_001272793.1
• RefSeq Size: 3679 bp
• RefSeq ORF: 744 bp
• Locus ID: 223828
• Cytogenetics: 15 E3
• MW: 28.6 kDa
• Gene Summary: Component of the HUSH complex, a multiprotein complex that mediates epigenetic repression. The HUSH complex is recruited to genomic loci rich in H3K9me3 and is probably required to maintain transcriptional silencing by promoting recruitment of SETDB1, a histone methyltransferase that mediates further deposition of H3K9me3. In the HUSH complex, contributes to the maintenance of the complex at chromatin. Acts as a transcriptional corepressor and regulates the cell cycle, probably via the HUSH complex. The HUSH complex is also involved in the silencing of unintegrated retroviral DNA: some part of the retroviral DNA formed immediately after infection remains unintegrated in the host genome and is transcriptionally repressed. May be involved in epithelial differentiation by contributing to epidermal integrity and barrier formation.[UniProtKB/Swiss-Prot Function]