G6pc2 (NM_001289856) Mouse Tagged ORF Clone

CAT#: MR228711

G6pc2 (myc-DDK-tagged) - Mouse glucose-6-phosphatase, catalytic, 2 (G6pc2), transcript variant 2

Product Images

Circular map for MR228711

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: G6pc2
• Synonyms: G6pc; G6pc-rs; I; IGRP
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR228711 representing NM_001289856
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGCTCATCGTGCGTCTGGTATGTCATGGTAACAGCTGCCCTAAGCTACACCATCAGCCGGATGGAGG
  AGTCCTCTGTCACTCTGCACAGACTGACCTGGTCCTTTCTGTGGAGTGTTTTCTGGTTGATTCAAATCAG
  CGTCTGCATCTCAAGAGTATTCATAGCCACACATTTCCCCCATCAGGTCATTCTTGGAGTGATTGGTGGG
  ATGCTAGTAGCCGAGGCCTTTGAACACACTCCAGGAGTCCACATGGCCAGCTTGAGTGTGTACCTGAAGA
  CCAACGTCTTCCTCTTCCTGTTTGCCCTCGGCTTTTACCTGCTTCTCCGACTGTTCGGTATTGACCTGCT
  GTGGTCCGTGCCCATCGCCAAAAAGTGGTGTGCCAACCCAGACTGGATCCACATTGACAGCACGCCTTTT
  GCTGGACTCGTGAGAAACCTCGGGGTCCTCTTTGGCTTGGGTTTCGCCATCAACTCAGAAATGTTCCTTC
  GGAGCTGCCAGGGAGAAAATGGCACCAAGCCGAGCTTCCGCTTGCTCTGTGCTCTGACCTCACTGACCAC
  AATGCAACTTTATCGCTTCATCAAGATCCCGACTCACGCGGAACCTTTATTTTACCTGTTGTCTTTCTGT
  AAAAGTGCGTCCATCCCCCTGATGGTGGTGGCTCTAATTCCCTACTGTGTACATATGTTAATGAGACCCG
  GTGACAAGAAGACTAAA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR228711 representing NM_001289856
  Red=Cloning site Green=Tags(s)
  
  MGSSCVWYVMVTAALSYTISRMEESSVTLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVILGVIGG
  MLVAEAFEHTPGVHMASLSVYLKTNVFLFLFALGFYLLLRLFGIDLLWSVPIAKKWCANPDWIHIDSTPF
  AGLVRNLGVLFGLGFAINSEMFLRSCQGENGTKPSFRLLCALTSLTTMQLYRFIKIPTHAEPLFYLLSFC
  KSASIPLMVVALIPYCVHMLMRPGDKKTK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001289856
• ORF Size: 717 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001289856.1, NP_001276785.1
• RefSeq Size: 1846 bp
• RefSeq ORF: 720 bp
• Locus ID: 14378
• UniProt ID: Q9Z186
• Cytogenetics: 2 39.66 cM
• MW: 27.4 kDa
• Gene Summary: This gene encodes an enzyme that belongs to the glucose-6-phosphatase catalytic subunit family. Members of this family catalyze the hydrolysis of glucose-6-phosphate, the terminal step in gluconeogenic and glycogenolytic pathways, to release glucose into the bloodstream. The family member encoded by this gene is found specifically in pancreatic islets but has not been shown to have phosphotransferase or phosphatase activity exhibited by a similar liver enzyme. The non-obese diabetic (NOD) mouse is a model for human type 1 diabetes, an autoimmune disease in which T lymphocytes attack and destroy insulin-producing pancreatic beta cells. In NOD mice, the protein encoded by this gene is a major target of cell-mediated autoimmunity. Variations in the human and mouse genes are associated with lower fasting plasma glucose levels. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]