Srsf10 (NM_001284196) Mouse Tagged ORF Clone

CAT#: MR228337

Srsf10 (myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 10 (Srsf10), transcript variant 4

Product Images

Circular map for MR228337

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Srsf10
• Synonyms: Fusip1; FUSIP2; Nssr; NSSR1; NSSR2; Sfrs13a; SRrp40; Srsf13a; TASR; TASR1; TASR2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR228337 representing NM_001284196
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCCCGATACCTGCGCCCCCCTAACACGTCTCTGTTCGTCAGGAACGTGGCGGACGACACCAGGTCTG
  AAGATTTACGTCGGGAATTTGGTCGTTATGGTCCAATAGTAGATGTTTATGTCCCACTTGATTTCTACAC
  TCGGCGTCCAAGAGGATTTGCATATGTTCAATTTGAGGATGTTCGTGATGCTGAAGACGCTTTACATAAT
  TTGGACAGAAAATGGATTTGTGGGCGTCAGATTGAAATCCAGTTCGCACAGGGGGATCGGAAGACACCAA
  ATCAAATGAAAGCCAAGGAAGGGAGGAATGTATACAGCTCTTCACGATATGACGATTATGACCGATATAG
  ACGCTCTCGAAGCCGGAGTTATGAAAGGAGAAGATCGAGGAGTCGCTCCTTTGATTATAACTATAGGAGA
  TCTTACAGTCCTAGAAATAGACCGACTGGAAGACCACGGCGTAGCCGAAGCCATTCCGACAATGATAGAC
  CAAACTGCAGCTGGAATACCCAGTACAGTTCTGCTTACTACACTTCAAGAAAGATC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR228337 representing NM_001284196
  Red=Cloning site Green=Tags(s)
  
  MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN
  LDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRR
  SYSPRNRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001284196
• ORF Size: 546 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001284196.1, NP_001271125.1
• RefSeq Size: 3433 bp
• RefSeq ORF: 549 bp
• Locus ID: 14105
• UniProt ID: Q9R0U0
• Cytogenetics: 4 D3
• MW: 22.6 kDa
• Gene Summary: Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. Also acts as a splicing factor that specifically promotes exon skipping during alternative splicing. Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, prevents SRSF10 from binding to its mRNA-binding sites close to m6A-containing regions, leading to inhibit exon skipping during alternative splicing (By similarity). May be involved in regulation of alternative splicing in neurons (PubMed:10583508).[UniProtKB/Swiss-Prot Function]