C8g (NM_001271777) Mouse Tagged ORF Clone

CAT#: MR228253

Reviews ()
Write a review
  • TrueORF®

C8g (myc-DDK-tagged) - Mouse complement component 8, gamma polypeptide (C8g), transcript variant 2


  View "NM_001271777" in other vectors (1)

Interest in protein/lysate? Sumbit request here!

USD 200.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name C8g (NM_001271777) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol C8g
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR228253 representing NM_001271777
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTTCCCCAATGCTACAGGGCACAGGGAGGCAGTTTGCAGGGACATGGCTCCTGGTGGCTGTGGGCT
CTTCGTGCCGCTTTCTTCAGGAGCAGGGACACCGAGCTGAGGCCACCACATTGCACGCAGCTCCCCAGGG
TGCAGCTATGGCTGTCAGCACCTTCCGAAAGCTAGATGGGATATGTTGGCAGGTACGCCAACTCTTTGAG
AACACAGGGGTCCCTGGCCGCTTCTTGTTCCAAGTCTCACGGGCCCGTGGACCAGTGCATATGGTGGTTG
CTGAGACTGACTATCAGAGCTTTGCCATCCTGTACCTGGAACAGGGAAGGAAGCTGTCTGTGAAACTATA
CGTCCGCTCACTGCCAGTGAATGACTCTGTCCTGGATGTGTTTGAGCGGCGAGTCAGGGAAGCCAACCTG
ACAGAAGATCAGATTCTTTTCTTTCCCAAGTATGGTTTCTGCGAGACTGCGGACCAATTACACATCCTGA
ACGAGGTGCCGCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR228253 representing NM_001271777
Red=Cloning site Green=Tags(s)

MPSPMLQGTGRQFAGTWLLVAVGSSCRFLQEQGHRAEATTLHAAPQGAAMAVSTFRKLDGICWQVRQLFE
NTGVPGRFLFQVSRARGPVHMVVAETDYQSFAILYLEQGRKLSVKLYVRSLPVNDSVLDVFERRVREANL
TEDQILFFPKYGFCETADQLHILNEVPR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001271777
ORF Size 504 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001271777.1, NP_001258706.1
RefSeq Size 823
RefSeq ORF 507
Locus ID 69379
Cytogenetics 2 17.31 cM
MW 19.4 kDa
Gene Summary This gene encodes a secreted protein that is a core component of the complement 8 (C8) complex. C8 is part of the membrane attack complex which participates in the innate immune response against bacterial pathogens. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2012]

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones