Ccl2 (NM_011333) Mouse Tagged ORF Clone

CAT#: MR226804

Ccl2 (Myc-DDK-tagged) - Mouse chemokine (C-C motif) ligand 2 (Ccl2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Ccl2 (NM_011333) Mouse Tagged ORF Clone
Symbol Ccl2
Synonyms AI323594; HC11; JE; MCAF; MCP-1; MCP1; Scya2; Sigje; SMC-CF
Vector pCMV6-Entry
Sequence Data
>MR226804 representing NM_011333
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGTCCCTGTCATGCTTCTGGGCCTGCTGTTCACAGTTGCCGGCTGGAGCATCCACGTGTTGGCTC
AGCCAGATGCAGTTAACGCCCCACTCACCTGCTGCTACTCATTCACCAGCAAGATGATCCCAATGAGTAG
GCTGGAGAGCTACAAGAGGATCACCAGCAGCAGGTGTCCCAAAGAAGCTGTAGTTTTTGTCACCAAGCTC
AAGAGAGAGGTCTGTGCTGACCCCAAGAAGGAATGGGTCCAGACATACATTAAAAACCTGGATCGGAACC
AAATGAGATCAGAACCTACAACTTTATTTAAAACTGCATCTGCCCTAAGGTCTTCAGCACCTTTGAATGT
GAAGTTGACCCGTAAATCTGAAGCTAATGCATCCACTACCTTTTCCACAACCACCTCAAGCACTTCTGTA
GGAGTGACCAGTGTGACAGTGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR226804 representing NM_011333
Red=Cloning site Green=Tags(s)

MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKL
KREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSV
GVTSVTVN

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_011333
ORF Size 444 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_011333.1, NM_011333.2, NM_011333.3, NP_035463
RefSeq Size 806
RefSeq ORF 447
Locus ID 20296
Cytogenetics 11 C|11 49.82 cM
MW 16.8 kDa
Gene Summary This gene is one of several cytokine genes clustered on chromosome 11. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and memory T cells but not for neutrophils. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis. [provided by RefSeq, Sep 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)