Ar (NM_013476) Mouse Tagged ORF Clone

USD 750.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Ar (NM_013476) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ar
Synonyms AW320017; Tfm
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR226737 representing NM_013476
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGCAGTTAGGGCTGGGAAGGGTCTACCCACGGCCCCCATCCAAGACCTATCGAGGAGCGTTCC
AGAATCTGTTCCAGAGCGTGCGCGAAGCGATCCAGAACCCGGGCCCCAGGCACCCTGAGGCCGCTAACAT
AGCACCTCCCGGCGCCTGTTTACAGCAGAGGCAGGAGACTAGCCCCCGGCGGCGGCGGCGGCAGCAGCAC
ACTGAGGATGGTTCTCCTCAAGCCCACATCAGAGGCCCCACAGGCTACCTGGCCCTGGAGGAGGAACAGC
AGCCTTCACAGCAGCAGGCAGCCTCCGAGGGCCACCCTGAGAGCAGCTGCCTCCCCGAGCCTGGGGCGGC
CACCGCTCCTGGCAAGGGGCTGCCGCAGCAGCCACCAGCTCCTCCAGATCAGGATGACTCAGCTGCCCCA
TCCACGTTGTCCCTGCTGGGCCCCACTTTCCCAGGCTTAAGCAGCTGCTCCGCCGACATTAAAGACATTT
TGAACGAGGCCGGCACCATGCAACTTCTTCAGCAGCAGCAACAACAGCAGCAGCACCAACAGCAGCACCA
ACAGCACCAACAGCAGCAGGAGGTAATCTCCGAAGGCAGCAGCGCAAGAGCCAGGGAGGCCACGGGGGCT
CCCTCTTCCTCCAAGGATAGTTACCTAGGGGGCAATTCAACCATATCTGACAGTGCCAAGGAGTTGTGTA
AAGCAGTGTCTGTGTCCATGGGATTGGGTGTGGAAGCATTGGAACATCTGAGTCCAGGGGAACAGCTTCG
GGGAGACTGCATGTACGCGTCGCTCCTGGGAGGTCCACCCGCGGTGCGTCCCACTCCTTGTGCGCCGCTG
CCCGAATGCAAAGGTCTTCCCCTGGACGAAGGCCCAGGCAAAAGCACTGAAGAGACTGCTGAGTATTCCT
CTTTCAAGGGAGGTTACGCCAAAGGATTGGAAGGTGAGAGCTTGGGGTGCTCTGGCAGCAGTGAAGCAGG
TAGCTCTGGGACACTTGAGATCCCGTCCTCTCTGTCTCTGTATAAATCTGGAGCACTAGACGAGGCAGCA
GCATACCAGAATCGCGACTACTACAACTTTCCGCTGGCTCTGTCCGGGCCGCCGCACCCCCCGCCCCCTA
CCCATCCACACGCCCGTATCAAGCTGGAGAACCCATTGGACTACGGCAGCGCCTGGGCTGCGGCGGCAGC
GCAATGCCGCTATGGGGACTTGGGTAGTCTACATGGAGGGAGTGTAGCCGGGCCCAGCACTGGATCGCCC
CCAGCCACCACCTCTTCTTCCTGGCATACTCTCTTCACAGCTGAAGAAGGCCAATTATATGGGCCAGGAG
GCGGGGGCGGCAGCAGCAGCCCAAGCGATGCCGGGCCTGTAGCCCCCTATGGCTACACTCGGCCCCCTCA
GGGGCTGACAAGCCAGGAGAGTGACTACTCTGCCTCCGAAGTGTGGTATCCTGGTGGAGTTGTGAACAGA
GTACCCTATCCCAGTCCCAATTGTGTCAAAAGTGAAATGGGACCTTGGATGGAGAACTACTCCGGACCTT
ATGGGGACATGCGTTTGGACAGTACCAGGGACCATGTTTTACCCATCGACTATTACTTTCCACCCCAGAA
GACCTGCCTGATCTGTGGAGATGAAGCTTCTGGCTGTCACTACGGAGCTCTCACTTGTGGCAGCTGCAAG
GTCTTCTTCAAAAGAGCCGCTGAAGGGAAACAGAAGTATCTATGTGCCAGCAGAAACGATTGTACCATTG
ATAAATTTCGGAGGAAAAATTGCCCATCTTGTCGTCTCCGGAAATGTTATGAAGCAGGGATGACTCTGGG
AGCTCGTAAGCTGAAGAAACTTGGAAATCTAAAACTACAGGAGGAAGGAGAAAACTCCAATGCTGGCAGC
CCCACTGAGGACCCATCCCAGAAGATGACTGTATCACACATTGAAGGCTATGAATGTCAGCCTATCTTTC
TTAACGTCCTGGAAGCCATTGAGCCAGGAGTGGTGTGTGCCGGACATGACAACAACCAACCAGATTCCTT
TGCTGCCTTGTTATCTAGCCTCAATGAGCTTGGAGAGAGGCAGCTTGTGCATGTGGTCAAGTGGGCCAAG
GCCTTGCCTGGCTTCCGCAACTTGCATGTGGATGACCAGATGGCGGTCATTCAGTATTCCTGGATGGGAC
TGATGGTATTTGCCATGGGTTGGCGGTCCTTCACTAATGTCAACTCCAGGATGCTCTACTTTGCACCTGA
CTTGGTTTTCAATGAGTACCGCATGCACAAGTCTCGGATGTACAGCCAGTGTGTGAGGATGAGGCACCTG
TCTCAAGAGTTTGGATGGCTCCAAATAACCCCCCAGGAATTCCTGTGCATGAAAGCACTGCTGCTCTTCA
GCATTATTCCAGTGGATGGGCTGAAAAATCAAAAATTCTTTGATGAACTTCGAATGAACTACATCAAGGA
ACTCGATCGCATCATTGCATGCAAAAGAAAGAATCCCACATCCTGCTCAAGGCGCTTCTACCAGCTCACC
AAGCTCCTGGATTCTGTGCAGCCTATTGCAAGAGAGCTGCATCAGTTCACTTTTGACCTGCTAATCAAGT
CCCATATGGTGAGCGTGGACTTTCCTGAAATGATGGCAGAGATCATCTCTGTGCAAGTGCCCAAGATCCT
TTCTGGGAAAGTCAAGCCCATCTATTTCCACACACAG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>MR226737 representing NM_013476
Red=Cloning site Green=Tags(s)

MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREAIQNPGPRHPEAANIAPPGACLQQRQETSPRRRRRQQH
TEDGSPQAHIRGPTGYLALEEEQQPSQQQAASEGHPESSCLPEPGAATAPGKGLPQQPPAPPDQDDSAAP
STLSLLGPTFPGLSSCSADIKDILNEAGTMQLLQQQQQQQQHQQQHQQHQQQQEVISEGSSARAREATGA
PSSSKDSYLGGNSTISDSAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYASLLGGPPAVRPTPCAPL
PECKGLPLDEGPGKSTEETAEYSSFKGGYAKGLEGESLGCSGSSEAGSSGTLEIPSSLSLYKSGALDEAA
AYQNRDYYNFPLALSGPPHPPPPTHPHARIKLENPLDYGSAWAAAAAQCRYGDLGSLHGGSVAGPSTGSP
PATTSSSWHTLFTAEEGQLYGPGGGGGSSSPSDAGPVAPYGYTRPPQGLTSQESDYSASEVWYPGGVVNR
VPYPSPNCVKSEMGPWMENYSGPYGDMRLDSTRDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCK
VFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGENSNAGS
PTEDPSQKMTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAK
ALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHL
SQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLT
KLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_013476
ORF Size 2697 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_013476.1, NM_013476.2, NM_013476.3, NM_013476.4, NP_038504.1
RefSeq Size 2999 bp
RefSeq ORF 2700 bp
Locus ID 11835
Cytogenetics X 42.82 cM
MW 98.6 kDa
Gene Summary This gene encodes a nuclear hormone receptor containing zinc finger and DNA-binding domains. The encoded protein is a key regulator of signalling by androgens, a class of steroid hormones involved in male reproductive development. The protein responds to hormone signalling by translocating to the nucleus, forming dimers, and binding to androgen response elements (AREs) in the promoters of target genes, which are subsequently transcriptionally activated. Activity of this protein is negatively regulated by nuclear receptor subfamily 0 group B member 1 (Nr0b1, also known as Dax1). Mutations in this gene result in feminized genitals and infertility in male animals. Loss of function in female animals also causes problems in reproductive development and function. [provided by RefSeq, May 2015]

Citations (1)

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools