Scd1 (NM_009127) Mouse Tagged ORF Clone

CAT#: MR225893

Scd1 (Myc-DDK-tagged) - Mouse stearoyl-Coenzyme A desaturase 1 (Scd1)

Change vector?

  • TrueORF®

USD 98

USD 490


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Scd1 (NM_009127) Mouse Tagged ORF Clone
Symbol Scd1
Synonyms AA589638; ab; AI265570; Scd; Scd-1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR225893 representing NM_009127
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGCCCACATGCTCCAAGAGATCTCCAGTTCTTACACGACCACCACCACCATCACTGCACCTCCCT
CCGGAAATGAACGAGAGAAGGTGAAGACGGTGCCCCTCCACCTGGAAGAAGACATCCGTCCTGAAATGAA
AGAAGATATTCACGACCCCACCTATCAGGATGAGGAGGGACCCCCGCCCAAGCTGGAGTACGTCTGGAGG
AACATCATTCTCATGGTCCTGCTGCACTTGGGAGGCCTGTACGGGATCATACTGGTTCCCTCCTGCAAGC
TCTACACCTGCCTCTTCGGGATTTTCTACTACATGACCAGCGCTCTGGGCATCACAGCCGGGGCTCATCG
CCTCTGGAGCCACAGAACTTACAAGGCACGGCTGCCCCTGCGGATCTTCCTTATCATTGCCAACACCATG
GCGTTCCAGAATGACGTGTACGAATGGGCCCGAGATCACCGCGCCCACCACAAGTTCTCAGAAACACACG
CCGACCCTCACAATTCCCGCCGTGGCTTCTTCTTCTCTCACGTGGGTTGGCTGCTTGTGCGCAAACACCC
GGCTGTCAAAGAGAAGGGCGGAAAACTGGACATGTCTGACCTGAAAGCCGAGAAGCTGGTGATGTTCCAG
AGGAGGTACTACAAGCCCGGCCTCCTGCTGATGTGCTTCATCCTGCCCACGCTGGTGCCCTGGTACTGCT
GGGGCGAGACTTTTGTAAACAGCCTGTTCGTTAGCACCTTCTTGCGATACACTCTGGTGCTCAACGCCAC
CTGGCTGGTGAACAGTGCCGCGCATCTCTATGGATATCGCCCCTACGACAAGAACATTCAATCCCGGGAG
AATATCCTGGTTTCCCTGGGTGCCGTGGGCGAGGGCTTCCACAACTACCACCACACCTTCCCCTTCGACT
ACTCTGCCAGTGAGTACCGCTGGCACATCAACTTCACCACGTTCTTCATCGACTGCATGGCTGCCCTGGG
CCTGGCTTACGACCGGAAGAAAGTTTCTAAGGCTACTGTCTTAGCCAGGATTAAGAGAACTGGAGACGGG
AGTCACAAGAGTAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR225893 representing NM_009127
Red=Cloning site Green=Tags(s)

MPAHMLQEISSSYTTTTTITAPPSGNEREKVKTVPLHLEEDIRPEMKEDIHDPTYQDEEGPPPKLEYVWR
NIILMVLLHLGGLYGIILVPSCKLYTCLFGIFYYMTSALGITAGAHRLWSHRTYKARLPLRIFLIIANTM
AFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQ
RRYYKPGLLLMCFILPTLVPWYCWGETFVNSLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRE
NILVSLGAVGEGFHNYHHTFPFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDG
SHKSS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_009127
ORF Size 1065 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_009127.1, NM_009127.2, NM_009127.3, NM_009127.4, NP_033153
RefSeq Size 4844
RefSeq ORF 1068
Locus ID 20249
Cytogenetics 19 C3|19 37.98 cM
MW 41.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations