Cd74 (NM_010545) Mouse Tagged ORF Clone

CAT#: MR225627

Cd74 (Myc-DDK-tagged) - Mouse CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated) (Cd74), transcript variant 2

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cd74 (NM_010545) Mouse Tagged ORF Clone
Symbol Cd74
Synonyms CLIP; DHLAG; HLADG; Ia-GAMMA; Ii
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR225627 representing NM_010545
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGACCAACGCGACCTCATCTCTAACCATGAACAGTTGCCCATACTGGGCAACCGCCCTAGAGAGC
CAGAAAGGTGCAGCCGTGGAGCTCTGTACACCGGTGTCTCTGTCCTGGTGGCTCTGCTCTTGGCTGGGCA
GGCCACCACTGCTTACTTCCTGTACCAGCAACAGGGCCGCCTAGACAAGCTGACCATCACCTCCCAGAAC
CTGCAACTGGAGAGCCTTCGCATGAAGCTTCCGAAATCTGCCAAACCTGTGAGCCAGATGCGGATGGCTA
CTCCCTTGCTGATGCGTCCAATGTCCATGGATAACATGCTCCTTGGGCCTGTGAAGAACGTTACCAAGTA
CGGCAACATGACCCAGGACCATGTGATGCATCTGCTCACGAGGTCTGGACCCCTGGAGTACCCGCAGCTG
AAGGGGACCTTCCCAGAGAATCTGAAGCATCTTAAGAACTCCATGGATGGCGTGAACTGGAAGATCTTCG
AGAGCTGGATGAAGCAGTGGCTCTTGTTTGAGATGAGCAAGAACTCCCTGGAGGAGAAGAAGCCCACCGA
GGCTCCACCTAAAGAGCCACTGGACATGGAAGACCTATCTTCTGGCCTGGGAGTGACCAGGCAGGAACTG
GGTCAAGTCACCCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR225627 representing NM_010545
Red=Cloning site Green=Tags(s)

MDDQRDLISNHEQLPILGNRPREPERCSRGALYTGVSVLVALLLAGQATTAYFLYQQQGRLDKLTITSQN
LQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQL
KGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQEL
GQVTL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010545
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010545.1, NM_010545.2, NM_010545.3, NP_034675
RefSeq Size 1239
RefSeq ORF 648
Locus ID 16149
Cytogenetics 18 E1|18 34.41 cM
MW 24.9 kDa
Gene Summary Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations