Rara (NM_001176528) Mouse Tagged ORF Clone

CAT#: MR225595

  • TrueORF®

Rara (Myc-DDK-tagged) - Mouse retinoic acid receptor, alpha (Rara), transcript variant 4

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_001176528" in other vectors (3)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Rara"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Rara
Synonyms Nr1b1; RAR; RARalpha1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR225595 representing NM_001176528
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACGAGAGTGTGGAAGTCGGGGGCCTTACCCCCGCCCCTAACCCCTTCCTAGTGGTGGACTTTTATA
ACCAGAACCGGGCCTGTTTGCTCCAGGAGAAGGGGCTCCCTGCCCCGGGTCCCTACTCCACCCCACTCCG
GACTCCGCTTTGGAATGGCTCAAACCACTCCATCGAGACCCAGAGCAGCAGTTCCGAAGAGATAGTACCC
AGCCCTCCCTCACCACCGCCCCTGCCCCGCATCTACAAGCCTTGCTTTGTTTGTCAAGACAAATCATCCG
GCTACCACTATGGGGTCAGCGCCTGTGAGGGCTGTAAGGGCTTCTTCCGACGAAGCATCCAGAAGAACAT
GGTGTATACGTGTCACCGGGACAAGAACTGCATCATCAACAAGGTGACCCGGAACCGCTGCCAGTACTGC
CGGCTGCAGAAATGTTTCGACGTGGGCATGTCCAAGGAGTCGGTGCGAAACGATCGAAACAAAAAGAAGA
AAGAGGCACCCAAGCCCGAGTGCTCAGAGAGCTACACGCTGACGCCTGAGGTGGGCGAGCTCATTGAGAA
GGTTCGCAAAGCGCACCAGGAGACCTTCCCGGCCCTCTGCCAGCTGGGCAAGTACACTACGAACAACAGC
TCAGAACAACGAGTCTCCCTGGACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCA
TTAAGACTGTGGAGTTCGCCAAGCAGCTTCCCGGCTTCACCACCCTCACCATCGCCGACCAGATCACCCT
CCTCAAGGCTGCCTGCCTGGATATCCTGATTCTGCGAATCTGCACGCGGTACACGCCTGAGCAAGACACA
ATGACCTTCTCAGATGGACTGACCCTGAACCGGACTCAGATGCACAACGCTGGCTTTGGCCCCCTCACCG
ACTTGGTCTTTGCCTTCGCCAACCAGCTGCTGCCCCTGGAGATGGACGATGCTGAGACTGGACTGCTCAG
TGCCATCTGCCTCATCTGTGGAGACCGACAGGACCTGGAGCAGCCAGACAAGGTGGACATGCTGCAAGAG
CCGCTGCTGGAAGCACTGAAAGTCTACGTCCGGAAACGGAGGCCCAGCCGACCCCACATGTTCCCCAAGA
TGCTGATGAAGATCACAGACCTTCGGAGCATCAGCGCCAAGGGAGCTGAACGGGTGATCACATTGAAGAT
GGAGATCCCAGGCTCCATGCCACCGCTGATCCAGGAAATGCTGGAGAACTCTGAGGGCTTGGACACTCTA
AGCGGACAGTCGGGGGGCGGAACACGAGATGGGGGTGGCCTGGCCCCCCCTCCGGGTAGCTGTAGCCCCA
GCCTCAGTCCCAGCTCCCACAGAAGCAGCCCAGCCACCCAATCCCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR225595 representing NM_001176528
Red=Cloning site Green=Tags(s)

MYESVEVGGLTPAPNPFLVVDFYNQNRACLLQEKGLPAPGPYSTPLRTPLWNGSNHSIETQSSSSEEIVP
SPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYC
RLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNS
SEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDT
MTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQE
PLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTL
SGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001176528
ORF Size 1377 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001176528.1, NP_001169999.1
RefSeq Size 3179 bp
RefSeq ORF 1380 bp
Locus ID 19401
UniProt ID P11416
Cytogenetics 11 62.76 cM
MW 50.9 kDa
Gene Summary Receptor for retinoic acid (PubMed:17205979). Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes (PubMed:17205979). The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5 (PubMed:17205979). In the absence of ligand, the RXR-RAR heterodimers associate with a multiprotein complex containing transcription corepressors that induce histone deacetylation, chromatin condensation and transcriptional suppression (By similarity). On ligand binding, the corepressors dissociate from the receptors and associate with the coactivators leading to transcriptional activation (PubMed:17205979, PubMed:9230306, PubMed:19078967). Formation of heterocomplex with histone deacetylases might lead to inhibition of RARE DNA element binding and to transcriptional repression (By similarity). Transcriptional activation and RARE DNA element binding might be supported by the transcription factor KLF2 (By similarity). RARA plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis (PubMed:15901285). Has a role in the survival of early spermatocytes at the beginning prophase of meiosis (PubMed:15901285, PubMed:17905941). In Sertoli cells, may promote the survival and development of early meiotic prophase spermatocytes (PubMed:10660575, PubMed:17905941). In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function (PubMed:19389355). Together with RXRA, positively regulates microRNA-10a expression, thereby inhibiting the GATA6/VCAM1 signaling response to pulsatile shear stress in vascular endothelial cells (By similarity). In association with HDAC3, HDAC5 and HDAC7 corepressors, plays a role in the repression of microRNA-10a and thereby promotes the inflammatory response (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.