Brsk1 (NM_001168572) Mouse Tagged ORF Clone

CAT#: MR220008

  • TrueORF®

Brsk1 (Myc-DDK-tagged) - Mouse BR serine/threonine kinase 1 (Brsk1), transcript variant 2

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001168572" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 503.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Brsk1 Antibody - C-terminal region
    • 100 ul

USD 539.00

Other products for "Brsk1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Brsk1
Synonyms Gm1100; SAD-B; SADB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR220008 representing NM_001168572
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTCCGGGTCCAAGGAAGGTGGCGGGGGCTCCCCCGCCTACCACCTCCCACACCCACACCCACACC
CACCCCAGCACGCCCAATATGTGGGCCCCTATCGCCTGGAGAAGACGCTGGGCAAAGGACAGACAGGTCT
AGTTAAACTTGGAGTCCACTGCATCACGGGTCAGAAGGTCGCTGTCAAGATCGTGAACAGGGAGAAGCTG
TCGGAATCGGTGCTGATGAAGGTGGAGAGGGAAATCGCCATCCTGAAGCTCATTGAACACCCGCACGTGC
TCAAGCTCCACGACGTCTACGAGAACAAGAAATATTTATACTTGGTTCTTGAGCACGTTTCTGGTGGTGA
GCTGTTCGACTACCTGGTAAAAAAAGGGAGACTGACACCCAAGGAGGCCCGGAAGTTCTTCCGCCAGATC
GTGTCAGCACTGGACTTCTGCCATAGCTACTCCATCTGTCACAGAGACTTGAAGCCAGAGAACCTGCTGT
TGGATGAGAAAAACAACATCCGCATCGCAGACTTTGGTATGGCGTCCCTGCAAGTGGGGGACAGCCTCCT
GGAGACCAGCTGCGGGTCCCCCCATTACGCATGTCCAGAGGTGATCAAGGGGGAAAAGTATGATGGCCGC
CGGGCAGACATGTGGAGCTGTGGAGTCATCCTATTTGCCCTGCTTGTGGGGGCACTGCCCTTCGATGACG
ACAACCTGCGCCAGCTACTGGAGAAGGTGAAACGTGGGGTCTTCCACATGCCTCACTTCATCCCTCCAGA
CTGCCAGAGCCTCCTGAGAGGGATGATTGAAGTGGAGCCCGAGAAAAGGCTCAGTCTGGAGCAAATTCAG
AAACATCCTTGGTATCTGGGCGGGAAACACGAACCAGACCCTTGCCTGGAGCCAGCCCCAGGCCGCAGAG
TAGCCATGCGTAGCCTGCCTTCCAATGGCGAGCTGGACCCTGACGTTCTGGAAAGCATGGCGTCTCTGGG
CTGCTTCAGAGACCGCGAGCGGCTGCACAGAGAACTGCGAAGCGAGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR220008 representing NM_001168572
Red=Cloning site Green=Tags(s)

MSSGSKEGGGGSPAYHLPHPHPHPPQHAQYVGPYRLEKTLGKGQTGLVKLGVHCITGQKVAVKIVNREKL
SESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQI
VSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPHYACPEVIKGEKYDGR
RADMWSCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQIQ
KHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001168572
ORF Size 1029 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001168572.1, NP_001162044.1
RefSeq Size 1391 bp
RefSeq ORF 1032 bp
Locus ID 381979
UniProt ID Q5RJI5
Cytogenetics 7 A1
MW 39.2 kDa
Gene Summary Serine/threonine-protein kinase that plays a key role in polarization of neurons and centrosome duplication. Phosphorylates CDC25B, CDC25C, MAPT/TAU, RIMS1, TUBG1, TUBG2 and WEE1. Following phosphorylation and activation by STK11/LKB1, acts as a key regulator of polarization of cortical neurons, probably by mediating phosphorylation of microtubule-associated proteins such as MAPT/TAU at 'Thr-504' and 'Ser-554'. Also regulates neuron polarization by mediating phosphorylation of WEE1 at 'Ser-642' in post-mitotic neurons, leading to down-regulate WEE1 activity in polarized neurons. In neurons, localizes to synaptic vesicles and plays a role in neurotransmitter release, possibly by phosphorylating RIMS1. Also acts as a positive regulator of centrosome duplication by mediating phosphorylation of gamma-tubulin (TUBG1 and TUBG2) at 'Ser-131', leading to translocation of gamma-tubulin and its associated proteins to the centrosome. Involved in the UV-induced DNA damage checkpoint response, probably by inhibiting CDK1 activity through phosphorylation and activation of WEE1, and inhibition of CDC25B and CDC25C.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.