Olfr1415 (NM_001011525) Mouse Tagged ORF Clone

CAT#: MR219484

  • TrueORF®

Olfr1415 (Myc-DDK-tagged) - Mouse olfactory receptor 1415 (Olfr1415)

  View "NM_001011525" in other vectors (6)

USD 68.00

USD 149.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Olfr1415 (NM_001011525) Mouse Tagged ORF Clone
Symbol Olfr1415
Synonyms MOR103-12
Vector pCMV6-Entry
Sequence Data
>MR219484 representing NM_001011525
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGGGGAGAACATCACCAAGGTCAGCACCTTCATCCTGCTGGGCTTCCCCACAGCCCCTGAGCTGC
AATACCTGCTCTTCCTCCTCTTCCTGCTCGCCTACCTCTTTGTGCTGGTGGAGAACCTGACCATCATCCT
CACTGTCTGGAGCAGCGCCTCCCTGCACAGACCCATGTACTACTTCCTGGGTTCCTTGTCTTTCCTAGAG
ATCTGGTATGTGTCAGACATCATCCCCAAAATGCTGGATGGCTTCCTCTTGCAGAGGAAACGCATCTCTT
TCACTGGCTGCATGACTCAGCTCTATTTTTTCATCTCCCTGGTGTGTACAGAGTGTGTACTCTTGGCTTC
CATGGCCTATGACCGCTATGTGGCCATCTGCCACCCCCTGCGCTACCAAGTCATCATGACCACAGGGCTA
TGTGTCCAGCTTGTGGCCTTCTCTTTTGCAAGTGCCTTCACAGTCTCTGTGATTAAGGTCTACTTTATCT
CCAGTGCCACCTTCTGTGGTTCCAATGTCTTGAACCACTTCTTCTGTGACATCTCCCCCATCCTCAAGCT
GGCCTGCACTGACTTCTCTACTGCAGAGCTGGTGGACTTCATCCTGGCCTTCATCATTCTGGTGTTCCCA
CTCTTGGCCACCATTCTTTCCTATGGCTACATCACCCTGGCTGTGCTGCGCATCCCTTCAGCCACAGGCC
GGTGGAGAGCCTTCTCCACCTGTGCCTCCCACCTCACTGTGGTCACCTTCTTCTATGTGGCCATGCTTTT
TATATATGTGAGACCCCAGGCCATTGATACCCGGAGCTCCAACAAGCTCATCTCTGCTGTGTACACTGTC
CTCACGCCCATCTTAAACCCCTTGATTTATTGCCTAAGGAACAAAGAGTTTAAGGATGCTGTGAAAAGGA
CCCTGGGTTTGGGTCACACTCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR219484 representing NM_001011525
Red=Cloning site Green=Tags(s)

MRGENITKVSTFILLGFPTAPELQYLLFLLFLLAYLFVLVENLTIILTVWSSASLHRPMYYFLGSLSFLE
IWYVSDIIPKMLDGFLLQRKRISFTGCMTQLYFFISLVCTECVLLASMAYDRYVAICHPLRYQVIMTTGL
CVQLVAFSFASAFTVSVIKVYFISSATFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFP
LLATILSYGYITLAVLRIPSATGRWRAFSTCASHLTVVTFFYVAMLFIYVRPQAIDTRSSNKLISAVYTV
LTPILNPLIYCLRNKEFKDAVKRTLGLGHTL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001011525
ORF Size 933 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001011525.1, NP_001011525
RefSeq Size 936
RefSeq ORF 936
Locus ID 258228
Cytogenetics 1|1 D
MW 35.2 kDa
Gene Summary Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].

Other Versions

Other products for "Olfr1415"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Order online and get additional $20 off!
40% off proteins and antibodies
68 Mouse Clones