Pde2a (NM_001143848) Mouse Tagged ORF Clone

CAT#: MR218307

  • TrueORF®

Pde2a (Myc-DDK-tagged) - Mouse phosphodiesterase 2A, cGMP-stimulated (Pde2a), transcript variant 1

  View "NM_001143848" in other vectors (6)

Interest in protein/lysate? Sumbit request here!

USD 68.00

USD 629.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Pde2a (NM_001143848) Mouse Tagged ORF Clone
Symbol Pde2a
Synonyms CGS-PDE; cGSPDE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR218307 representing NM_001143848
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCAGGCATGCGGCCACTCCATCCTCTGCAGGAGCCAGCAGTACCCGGCAGCGCGACCGGCTGAGC
CGCGGGGCCAGCAGGTCTTCCTCAAGCCGGACGAGCCGCCGCCGCAGCCATGCGCCGACAGCCTGCAGGA
TGCTTTGCTGAGCCTAGGCGCCGTTATCGACATTGCTGGCCTGCGACAGGCTGCCAGGGATGCCCTCTCA
GCCGTGCTCCCCAAAGTGGAGACTGTCTACACCTACCTGCTAGATGGGGAGTCCAGACTGGTGTGTGAGG
ACCCCCCTCATGAGCTGCCACAGGAAGGAAAAATTCGAGAAGCTGTGATCTCTCAGAAGCGGCTGAGTTG
CAATGGGCTGGGACCTTCGGACCTACTGGGAAAGCCCTTGGCCAGGCTGGTGGCTCCACTGGCTCCTGAC
ATGCAAGTGCTGGTCATACCCCTGCTGGACAAGGAGACTGGAAGTGTGGCAGCTGTCATCTTGGTGCACT
GTGGCCAGCTGAGTGACAGTGAGGAACAGAGCTTGCAGGTGGTAGAGAAGCACGCTCTGGTAGCCCTGCG
GAGGGTGCAGGCCCTGCAGCAGCGCAGGCCTGAAGCTGTTCAGAACACGTCAGTGGATGCCTCTGAAGAT
CAAAAGGATGAGAAGGGGTACACCGACCATGACCGAAAGATCCTGCAACTGTGTGGGGAACTCTTTGACT
TGGATGCTACTTCTCTGCAGCTCAAAGTCCTTCAATATCTGCAGCAGGAGACACAGGCCACTCACTGCTG
CCTCCTGCTGGTGTCGGAGGACAATCTACAGCTTTCCTGCAAGGTCATTGGAGACAAAGTGCTGGGAGAA
GAGGTCAGCTTTCCATTGACCATGGGACGTCTGGGGCAGGTGGTGGAAGACAAGCAGTGTATCCAGTTGA
AGGACCTAACCTCTGACGATGTGCAACAGCTGCAAAACATGTTGGGTTGTGAGCTGCAGGCTATGCTGTG
TGTCCCTGTCATCAGCCGAGCCACTGACCAGGTGGTGGCCCTGGCTTGCGCCTTCAACAAGCTTGGAGGA
GATTTCCCGACTTCCAGCTTCACAGATGAGGATGAACACGTGATCCAACACTGCTTCCACTACACAGGCA
CGGTGCTCACCAGCACCTTGGCCTTCCAGAAGGAGCAGAAGCTCAAGTGTGAGTGCCAGGCTCTTCTCCA
AGTGGCAAAGAACCTCTTCACCCACCTGGATGATGTCTCTGTCCTGCTACAGGAGATCATCACGGAAGCC
AGAAACCTCAGCAACGCAGAGATCTGCTCGGTGTTCCTGCTGGATCAGAACGAGCTGGTGGCCAAGGTGT
TCGATGGTGGCGTTGTGGACGATGAGAGTTATGAGATCCGCATCCCGGCGGACCAAGGCATCGCGGGCCA
CGTGGCGACTACGGGCCAGATCCTGAACATCCCAGATGCATATGCCCATCCGCTTTTCTATCGCGGCGTA
GATGACAGCACTGGCTTCCGCACGCGCAACATTCTCTGCTTCCCTATCAAGAACGAGAACCAGGAGGTCA
TTGGTGTGGCTGAGCTAGTGAACAAGATCAATGGGCCATGGTTCAGCAAGTTTGATGAGGACCTGGCCAC
AGCCTTCTCCATCTACTGTGGCATCAGCATCGCCCACTCTCTCCTATACAAAAAGGTGAATGAAGCCCAA
TACCGCAGCCACCTGGCCAATGAGATGATGATGTATCATATGAAGGTCTCTGATGATGAATACACCAAGC
TTCTCCACGATGGCATCCAACCTGTGGCCGCCATTGACTCCAACTTTGCCAACTTTACCTACACGCCTCG
GTCTCTGCCTGAGGACGACACTTCTATGGCCATCCTGAGCATGCTGCAAGACATGAACTTCATCAATAAC
TACAAAATTGACTGCCCAACTCTGGCCCGATTCTGCCTGATGGTGAAGAAAGGCTACCGGGATCCACCCT
ACCACAACTGGATGCACGCCTTCTCTGTCTCTCATTTTTGCTACCTGCTCTACAAGAATCTGGAGCTCTC
CAACTACCTCGAGGACATCGAGATCTTTGCATTGTTTATTTCCTGCATGTGTCATGACCTGGACCACAGA
GGCACAAACAACTCCTTCCAGGTGGCCTCGAAATCTGTGCTGGCCGCACTCTACAGCTCAGAGGGCTCTG
TCATGGAGAGGCACCACTTTGCTCAAGCCATTGCTATCCTCAACACCCACGGCTGCAATATCTTTGACCA
CTTCTCTCGGAAGGACTATCAGCGCATGCTGGACCTGATGAGGGACATCATCTTGGCTACAGACCTGGCA
CACCACCTCCGCATCTTCAAGGACCTGCAGAAGATGGCTGAAGTGGGTTATGACCGAAACAACAGGCAAC
ACCACAGGCTTCTTCTGTGCCTCCTCATGACCTCCTGTGACCTCTCTGACCAGACAAAGGGCTGGAAGAC
CACCAGAAAGATTGCAGAGCTGATCTACAAAGAGTTCTTCTCCCAGGGAGACTTGGAGAAGGCCATGGGC
AACCGACCGATGGAGATGATGGACCGTGAGAAGGCCTACATCCCTGAGCTTCAGATCAGCTTTATGGAGC
ACATTGCCATGCCTATCTACAAGCTTTTACAAGACCTGTTCCCCAAGGCGGCAGAGCTGTATGAACGTGT
GGCCTCCAACCGTGAGCACTGGACCAAGGTGTCCCACAAGTTCACCATCCGAGGCCTCCCCAGTAACAAC
TCGCTGGATTTCCTGGACGAGGAATACGAGGTCCCCGATTTGGACGGCACCAGAGCTCCTGTCAATGGCT
GCTGCAGCCTCGAGGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR218307 representing NM_001143848
Red=Cloning site Green=Tags(s)

MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAGLRQAARDALS
AVLPKVETVYTYLLDGESRLVCEDPPHELPQEGKIREAVISQKRLSCNGLGPSDLLGKPLARLVAPLAPD
MQVLVIPLLDKETGSVAAVILVHCGQLSDSEEQSLQVVEKHALVALRRVQALQQRRPEAVQNTSVDASED
QKDEKGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGE
EVSFPLTMGRLGQVVEDKQCIQLKDLTSDDVQQLQNMLGCELQAMLCVPVISRATDQVVALACAFNKLGG
DFPTSSFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEA
RNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGV
DDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQ
YRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINN
YKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHR
GTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLA
HHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMG
NRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNN
SLDFLDEEYEVPDLDGTRAPVNGCCSLEG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001143848
ORF Size 2817 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001143848.1, NM_001143848.2, NP_001137320
RefSeq Size 4227
RefSeq ORF 2820
Locus ID 207728
Cytogenetics 7|7 E2
MW 106.1 kDa

Other Versions

Other products for "Pde2a"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Order online and get additional $20 off!
40% off proteins and antibodies
68 Mouse Clones