Pde2a (NM_001143848) Mouse Tagged ORF Clone

CAT#: MG218307

Reviews ()
Write a review
  • TrueORF®

Pde2a (GFP-tagged) - Mouse phosphodiesterase 2A cGMP-stimulated (Pde2a) transcript variant 1, (10ug)

  View "NM_001143848" in other vectors (6)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 1,360.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Pde2a (NM_001143848) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Pde2a
Synonyms CGS-PDE; cGSPDE
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>MG218307 representing NM_001143848
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCAGGCATGCGGCCACTCCATCCTCTGCAGGAGCCAGCAGTACCCGGCAGCGCGACCGGCTGAGC
CGCGGGGCCAGCAGGTCTTCCTCAAGCCGGACGAGCCGCCGCCGCAGCCATGCGCCGACAGCCTGCAGGA
TGCTTTGCTGAGCCTAGGCGCCGTTATCGACATTGCTGGCCTGCGACAGGCTGCCAGGGATGCCCTCTCA
GCCGTGCTCCCCAAAGTGGAGACTGTCTACACCTACCTGCTAGATGGGGAGTCCAGACTGGTGTGTGAGG
ACCCCCCTCATGAGCTGCCACAGGAAGGAAAAATTCGAGAAGCTGTGATCTCTCAGAAGCGGCTGAGTTG
CAATGGGCTGGGACCTTCGGACCTACTGGGAAAGCCCTTGGCCAGGCTGGTGGCTCCACTGGCTCCTGAC
ATGCAAGTGCTGGTCATACCCCTGCTGGACAAGGAGACTGGAAGTGTGGCAGCTGTCATCTTGGTGCACT
GTGGCCAGCTGAGTGACAGTGAGGAACAGAGCTTGCAGGTGGTAGAGAAGCACGCTCTGGTAGCCCTGCG
GAGGGTGCAGGCCCTGCAGCAGCGCAGGCCTGAAGCTGTTCAGAACACGTCAGTGGATGCCTCTGAAGAT
CAAAAGGATGAGAAGGGGTACACCGACCATGACCGAAAGATCCTGCAACTGTGTGGGGAACTCTTTGACT
TGGATGCTACTTCTCTGCAGCTCAAAGTCCTTCAATATCTGCAGCAGGAGACACAGGCCACTCACTGCTG
CCTCCTGCTGGTGTCGGAGGACAATCTACAGCTTTCCTGCAAGGTCATTGGAGACAAAGTGCTGGGAGAA
GAGGTCAGCTTTCCATTGACCATGGGACGTCTGGGGCAGGTGGTGGAAGACAAGCAGTGTATCCAGTTGA
AGGACCTAACCTCTGACGATGTGCAACAGCTGCAAAACATGTTGGGTTGTGAGCTGCAGGCTATGCTGTG
TGTCCCTGTCATCAGCCGAGCCACTGACCAGGTGGTGGCCCTGGCTTGCGCCTTCAACAAGCTTGGAGGA
GATTTCCCGACTTCCAGCTTCACAGATGAGGATGAACACGTGATCCAACACTGCTTCCACTACACAGGCA
CGGTGCTCACCAGCACCTTGGCCTTCCAGAAGGAGCAGAAGCTCAAGTGTGAGTGCCAGGCTCTTCTCCA
AGTGGCAAAGAACCTCTTCACCCACCTGGATGATGTCTCTGTCCTGCTACAGGAGATCATCACGGAAGCC
AGAAACCTCAGCAACGCAGAGATCTGCTCGGTGTTCCTGCTGGATCAGAACGAGCTGGTGGCCAAGGTGT
TCGATGGTGGCGTTGTGGACGATGAGAGTTATGAGATCCGCATCCCGGCGGACCAAGGCATCGCGGGCCA
CGTGGCGACTACGGGCCAGATCCTGAACATCCCAGATGCATATGCCCATCCGCTTTTCTATCGCGGCGTA
GATGACAGCACTGGCTTCCGCACGCGCAACATTCTCTGCTTCCCTATCAAGAACGAGAACCAGGAGGTCA
TTGGTGTGGCTGAGCTAGTGAACAAGATCAATGGGCCATGGTTCAGCAAGTTTGATGAGGACCTGGCCAC
AGCCTTCTCCATCTACTGTGGCATCAGCATCGCCCACTCTCTCCTATACAAAAAGGTGAATGAAGCCCAA
TACCGCAGCCACCTGGCCAATGAGATGATGATGTATCATATGAAGGTCTCTGATGATGAATACACCAAGC
TTCTCCACGATGGCATCCAACCTGTGGCCGCCATTGACTCCAACTTTGCCAACTTTACCTACACGCCTCG
GTCTCTGCCTGAGGACGACACTTCTATGGCCATCCTGAGCATGCTGCAAGACATGAACTTCATCAATAAC
TACAAAATTGACTGCCCAACTCTGGCCCGATTCTGCCTGATGGTGAAGAAAGGCTACCGGGATCCACCCT
ACCACAACTGGATGCACGCCTTCTCTGTCTCTCATTTTTGCTACCTGCTCTACAAGAATCTGGAGCTCTC
CAACTACCTCGAGGACATCGAGATCTTTGCATTGTTTATTTCCTGCATGTGTCATGACCTGGACCACAGA
GGCACAAACAACTCCTTCCAGGTGGCCTCGAAATCTGTGCTGGCCGCACTCTACAGCTCAGAGGGCTCTG
TCATGGAGAGGCACCACTTTGCTCAAGCCATTGCTATCCTCAACACCCACGGCTGCAATATCTTTGACCA
CTTCTCTCGGAAGGACTATCAGCGCATGCTGGACCTGATGAGGGACATCATCTTGGCTACAGACCTGGCA
CACCACCTCCGCATCTTCAAGGACCTGCAGAAGATGGCTGAAGTGGGTTATGACCGAAACAACAGGCAAC
ACCACAGGCTTCTTCTGTGCCTCCTCATGACCTCCTGTGACCTCTCTGACCAGACAAAGGGCTGGAAGAC
CACCAGAAAGATTGCAGAGCTGATCTACAAAGAGTTCTTCTCCCAGGGAGACTTGGAGAAGGCCATGGGC
AACCGACCGATGGAGATGATGGACCGTGAGAAGGCCTACATCCCTGAGCTTCAGATCAGCTTTATGGAGC
ACATTGCCATGCCTATCTACAAGCTTTTACAAGACCTGTTCCCCAAGGCGGCAGAGCTGTATGAACGTGT
GGCCTCCAACCGTGAGCACTGGACCAAGGTGTCCCACAAGTTCACCATCCGAGGCCTCCCCAGTAACAAC
TCGCTGGATTTCCTGGACGAGGAATACGAGGTCCCCGATTTGGACGGCACCAGAGCTCCTGTCAATGGCT
GCTGCAGCCTCGAGGGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG218307 representing NM_001143848
Red=Cloning site Green=Tags(s)

MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEPPPQPCADSLQDALLSLGAVIDIAGLRQAARDALS
AVLPKVETVYTYLLDGESRLVCEDPPHELPQEGKIREAVISQKRLSCNGLGPSDLLGKPLARLVAPLAPD
MQVLVIPLLDKETGSVAAVILVHCGQLSDSEEQSLQVVEKHALVALRRVQALQQRRPEAVQNTSVDASED
QKDEKGYTDHDRKILQLCGELFDLDATSLQLKVLQYLQQETQATHCCLLLVSEDNLQLSCKVIGDKVLGE
EVSFPLTMGRLGQVVEDKQCIQLKDLTSDDVQQLQNMLGCELQAMLCVPVISRATDQVVALACAFNKLGG
DFPTSSFTDEDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEA
RNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVATTGQILNIPDAYAHPLFYRGV
DDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQ
YRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFANFTYTPRSLPEDDTSMAILSMLQDMNFINN
YKIDCPTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLEDIEIFALFISCMCHDLDHR
GTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLA
HHLRIFKDLQKMAEVGYDRNNRQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMG
NRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFTIRGLPSNN
SLDFLDEEYEVPDLDGTRAPVNGCCSLEG

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001143848
ORF Size 2817 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001143848.2, NP_001137320.1
RefSeq Size 4227
RefSeq ORF 2820
Locus ID 207728
Cytogenetics 7 E2

Other Versions

Other products for "Pde2a"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones