Ostn (NM_198112) Mouse Tagged ORF Clone
CAT#: MR215395
- TrueORF®
Ostn (Myc-DDK-tagged) - Mouse osteocrin (Ostn)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_198112" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Ostn |
Synonyms | Ostc |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR215395 representing NM_198112
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCTGGACTGGAGATTGGCAAGTACACACTTCATCCTGGCTATGATTGTGATGCTGTGGGGCTCAGGAA AGGCATTCTCTGTGGACTTAGCATCACAGGAGTTTGGAACAGCAAGCTTGCAGTCTCCACCCACAGCCAG AGAAGAGAAGTCAGCCACTGAGCTTTCGGCTAAGCTCCTGCGTCTTGATGATCTGGTGTCCTTAGAGAAT GACGTATTTGAGACCAAGAAAAAGAGAAGCTTCTCTGGCTTTGGGTCTCCCCTTGACAGACTCTCAGCTG GGTCTGTAGAGCATAGAGGGAAACAAAGGAAAGCAGTAGATCATTCAAAAAAGCGGTTTGGTATTCCCAT GGATCGGATTGGTAGAAACCGGCTCTCCAGTTCCAGAGGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR215395 representing NM_198112
Red=Cloning site Green=Tags(s) MLDWRLASTHFILAMIVMLWGSGKAFSVDLASQEFGTASLQSPPTAREEKSATELSAKLLRLDDLVSLEN DVFETKKKRSFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSRG myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_198112 |
ORF Size | 390 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_198112.2, NP_932780.1 |
RefSeq Size | 1268 bp |
RefSeq ORF | 393 bp |
Locus ID | 239790 |
UniProt ID | P61364 |
Cytogenetics | 16 B2 |
MW | 14.9 kDa |
Gene Summary | Hormone that acts as a ligand for natriuretic peptide receptor NPR3/NPR-C and promotes bone growth and physical endurance in muscle. Acts as a regulator of osteoblast differentiation and bone growth by binding to natriuretic peptide receptor NPR3/NPR-C, thereby preventing binding between NPR3/NPR-C and natriuretic peptides, leading to increase cGMP production (PubMed:14523025, PubMed:17951249). Required to enhance physical endurance: induced following physical exercise in muscle and promotes cGMP production, probably by interacting with NPR3/NPR-C (PubMed:26668395). May act as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle (PubMed:15044443).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC213087 | Ostn (untagged) - Mouse osteocrin (Ostn), (10ug) |
USD 165.00 |
|
MG215395 | Ostn (tGFP-tagged) - Mouse osteocrin (Ostn), (10ug) |
USD 425.00 |
|
MR215395L3 | Lenti ORF clone of Ostn (Myc-DDK-tagged) - Mouse osteocrin (Ostn) |
USD 525.00 |
|
MR215395L4 | Lenti ORF clone of Ostn (mGFP-tagged) - Mouse osteocrin (Ostn) |
USD 525.00 |
{0} Product Review(s)
Be the first one to submit a review