Abcb8 (NM_029020) Mouse Tagged ORF Clone

CAT#: MR210248

Abcb8 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family B (MDR/TAP), member 8 (Abcb8), nuclear gene encoding mitochondrial protein

Change vector?

  • TrueORF®

USD 98

USD 890


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Abcb8 (NM_029020) Mouse Tagged ORF Clone
Symbol Abcb8
Synonyms 4833412N02Rik; AA409895
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR210248 representing NM_029020
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGTGCACTTATTTCGGTTCGGAATCCGGGGTGGCCCAGTTCCAGGATGGTCGCTACAATCCCTGC
GCTTCCAGACGTTCTCTGCCGCCAGGTCCTCAGATGACCGGCTCAGCTCACACCTCCTGCGGACTGTAGC
CCAGCTCCGTGTACAGCTCCGGGCTCACCTCCCTCGAGCCCCACCAGCTTCCCACTGGAGCCCCTCTGCC
TGGTGTTGGGTTGGGGGGACCTTGGTGGTCCCTGCAGTCCTGTGGCAGCATCCACGCCTCTGCCTTATAG
CACTATGTGAGGCCAAAGAGTCCCCTCCTGCCCAGCCCACACGTGCCCCAGAGCTGCGCTTTAATTGGAA
GCTCTTCTGGCATTTCCTTCACCCCCACCTGCTGGCCTTGGGGGCAGCCATTGTGCTGGCCTTAGGTGCG
GCACTAGTGAATGTGCAGATCCCCTTGCTCCTGGGCCAGCTGGTGGAGATTGTCGCCAAGTACACGAGGG
ACCACATGGGGAGTTTCGTGTCTGAGTCCCGTAAGCTCAGCGTCCAGCTGCTCCTACTGTACGGTGTTCA
GGGACTGCTGACCTTTGGATACCTAGTGCTGCTGTCCCACATTGGTGAGCGCATGGCCATGGACATGCGG
AAAGCCCTTTTCAGCTCCCTGCTCCGGCAAGACATTGCTTTCTTTGATGCCAAAAAGACAGGGCAGCTAG
TGAGTCGCTTGACTACTGATGTGCAAGAATTCAAGTCATCCTTCAAGCTTGTCATCTCCCAGGGACTGCG
CAGCTGCACCCAGGTGATTGGTAGCCTGGTGTCCCTGTCTATGCTGTCCCCTCGCCTTACCCTGATGCTG
GCTGTCGTCACACCCGCCCTCATGGGAGTGGGCACCCTGATGGGCTCAGGCCTCCGAAAGCTGTCTCGCC
AGTGTCAGGAGCAGATTGCCAGGGCAACAGGTGTAGCAGATGAGGCCCTTGGCAATGTTCGGACTGTGCG
GGCCTTCGCGATGGAGAAGAGGGAGGAGGAACGCTATCAAGCAGAACTGGAGTCATGCTGCTGTAAAGCA
GAAGAACTGGGCAGGGGCATCGCCTTGTTCCAAGGGCTCTCCAACATCGCTTTCAACTGTATGGTCTTGG
GCACCCTGTTCATTGGGGGCTCCCTTGTGGCTGGACAGCAGCTGAAAGGGGGAGACCTCATGTCCTTCCT
GGTGGCTTCCCAGACAGTACAGAGGTCTATGGCCAGCCTCTCTGTCCTGTTTGGTCAGGTGGTACGTGGG
CTGAGTGCGGGAGCCCGAGTCTTCGAATACATGGCCCTGAGCCCTGTCATCCCATTGACCGGGGGCTACT
GCATCCCCAACAAGGACATTCGTGGTTCCATCACCTTCCAAAATGTCACCTTCAGCTACCCCTGCAGACC
TGGCTTCAATGTGCTCAAGGACTTCACCCTGAAGCTGCCCTCTGGCAAGATTGTGGCTCTTGTGGGCCAG
TCTGGGGGAGGAAAGACCACAGTTGCCTCCTTGCTGGAACGCTTCTATGACCCTGAAGCTGGCTCGGTGA
CGTTGGATGGGCATGACCTGCGAACTCTCAACCCCTCCTGGCTCCGGGGCCAGGTCATAGGTTTCATCAG
CCAGGAGCCAGTCCTGTTTGCAACAACCATCATGGAGAATATCCGATTTGGGAAGCTGGATGCTTCCGAT
GAAGAGGTGTACACAGCTGCACGAGAAGCCAATGCCCACGAGTTCATCAGCAGCTTCCCCGATGGCTACA
GCACTGTGGTTGGTGAGCGGGGCACAACCTTGTCTGGTGGCCAGAAGCAGCGCCTAGCCATCGCACGTGC
CCTCATCAAGCAGCCCACAGTGCTGATCCTGGACGAGGCCACCAGTGCGCTAGATGCAGAATCCGAGAGG
GTGGTACAGGAGGCCCTGGACCGGGCCAGTGCTGGCCGCACCGTGTTGGTCATTGCCCACCGGCTTAGTA
CTGTCCGTGCAGCCCACTCCATCATTGTCATGGCCAATGGCCAAGTCTGTGAGGCTGGGACCCACGAAGA
ACTCCTTAAAAAAGGCGGGCTCTATTCAGAGCTTATCCGGAGACAAACCCTGGACGCCTCACTGACCTCA
ACCCCTCCTGCAGAGAAGCCTGAAGACCCCAAAAGCTGCCAGTCCAAAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR210248 representing NM_029020
Red=Cloning site Green=Tags(s)

MLVHLFRFGIRGGPVPGWSLQSLRFQTFSAARSSDDRLSSHLLRTVAQLRVQLRAHLPRAPPASHWSPSA
WCWVGGTLVVPAVLWQHPRLCLIALCEAKESPPAQPTRAPELRFNWKLFWHFLHPHLLALGAAIVLALGA
ALVNVQIPLLLGQLVEIVAKYTRDHMGSFVSESRKLSVQLLLLYGVQGLLTFGYLVLLSHIGERMAMDMR
KALFSSLLRQDIAFFDAKKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVIGSLVSLSMLSPRLTLML
AVVTPALMGVGTLMGSGLRKLSRQCQEQIARATGVADEALGNVRTVRAFAMEKREEERYQAELESCCCKA
EELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLKGGDLMSFLVASQTVQRSMASLSVLFGQVVRG
LSAGARVFEYMALSPVIPLTGGYCIPNKDIRGSITFQNVTFSYPCRPGFNVLKDFTLKLPSGKIVALVGQ
SGGGKTTVASLLERFYDPEAGSVTLDGHDLRTLNPSWLRGQVIGFISQEPVLFATTIMENIRFGKLDASD
EEVYTAAREANAHEFISSFPDGYSTVVGERGTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESER
VVQEALDRASAGRTVLVIAHRLSTVRAAHSIIVMANGQVCEAGTHEELLKKGGLYSELIRRQTLDASLTS
TPPAEKPEDPKSCQSKA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_029020
ORF Size 2151 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_029020.2, NP_083296
RefSeq Size 2962
RefSeq ORF 2154
Locus ID 74610
Cytogenetics 5|5 A3
MW 78.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.