Gusb (NM_010368) Mouse Tagged ORF Clone

CAT#: MR209741

Gusb (Myc-DDK-tagged) - Mouse glucuronidase, beta (Gusb)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 499.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Gusb (NM_010368) Mouse Tagged ORF Clone
Symbol Gusb
Synonyms AI747421; asd; g; Gur; Gus; Gus-r; Gus-s; Gus-t; Gus-u; Gut
Vector pCMV6-Entry
Sequence Data
>MR209741 representing NM_010368
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCTAAAATGGAGTGCGTGTTGGGTCGCGCTGGGCCAGCTGCTGTGCAGCTGCGCGCTGGCTCTGA
AGGGCGGGATGCTGTTCCCGAAGGAGAGCCCGTCGCGGGAGCTCAAGGCGCTGGACGGACTGTGGCACTT
CCGCGCCGACCTCTCGAACAACCGGCTGCAGGGTTTCGAGCAGCAATGGTACCGGCAGCCGCTACGGGAG
TCGGGCCCAGTCTTGGACATGCCTGTCCCTTCTAGCTTCAATGACATCACCCAAGAAGCAGCCCTTCGGG
ACTTTATTGGCTGGGTGTGGTATGAACGGGAAGCAATCCTGCCACGGCGATGGACCCAAGATACCGACAT
GAGAGTGGTGTTGAGGATCAACAGTGCCCATTATTATGCAGTTGTGTGGGTGAATGGGATTCATGTGGTG
GAACATGAGGGAGGTCACCTCCCCTTTGAGGCTGACATTAGCAAGCTGGTCCAGAGTGGGCCCCTGACCA
CCTGCCGGATCACGATTGCCATCAACAACACACTGACCCCTCATACCCTTCCGCCGGGGACCATCGTCTA
CAAGACTGACACCTCCATGTATCCCAAGGGTTACTTTGTCCAGGACACAAGCTTTGACTTCTTCAACTAT
GCGGGACTGCATCGATCTGTGGTCCTCTATACCACCCCTACCACTTACATCGATGATATCACTGTGATCA
CTAATGTGGAGCAAGACATCGGGCTGGTGACCTACTGGATTTCTGTGCAGGGCAGTGAACATTTCCAGCT
AGAAGTGCAACTTTTGGATGAGGGTGGCAAAGTCGTGGCCCATGGGACAGGGAACCAGGGTCAACTTCAG
GTTCCCAGTGCCAACCTCTGGTGGCCTTACCTGATGCATGAGCATCCAGCCTACATGTACTCCTTGGAGG
TGAAGGTGACAACAACTGAGTCTGTGACTGACTACTACACCCTTCCTATCGGGATTCGAACAGTGGCTGT
CACAAAGAGCAAGTTCCTCATAAACGGGAAGCCCTTCTATTTCCAAGGGGTCAATAAGCACGAGGATTCA
GATATCCGAGGGAAAGGCTTCGACTGGCCGCTGCTGGTAAAGGATTTCAACCTGCTCCGTTGGCTCGGGG
CAAATTCCTTTCGTACCAGCCACTATCCCTACTCAGAGGAGGTACTTCAGCTCTGTGACCGATACGGGAT
TGTGGTCATCGATGAGTGTCCCGGTGTGGGCATTGTGCTACCTCAGAGTTTTGGCAACGAGTCACTTCGG
CACCACCTAGAGGTGATGGAGGAGCTGGTTCGCCGGGACAAAAATCACCCTGCGGTTGTGATGTGGTCTG
TGGCCAATGAGCCTTCCTCTGCTCTGAAACCCGCCGCATATTACTTTAAGACGCTGATCACCCACACCAA
AGCCCTGGACCTCACCCGTCCCGTGACCTTTGTGAGCAACGCCAAATATGATGCAGACCTGGGGGCCCCG
TACGTGGATGTTATCTGTGTAAACAGCTACTTTTCTTGGTATCATGACTATGGGCATTTGGAGGTGATTC
AGCCACAGCTGAATAGCCAGTTTGAGAACTGGTATAAGACGCATCAGAAGCCGATTATCCAGAGCGAGTA
TGGAGCAGACGCAATCCCAGGGATCCACGAGGACCCGCCTCGCATGTTCAGTGAGGAGTACCAGAAGGCT
GTTCTGGAGAATTACCATTCAGTTCTGGATCAGAAACGTAAAGAATACGTGGTCGGAGAGCTCATCTGGA
ATTTCGCCGACTTCATGACGAACCAGTCACCGCTGAGAGTAATCGGAAACAAGAAGGGGATCTTCACTCG
CCAGAGACAGCCCAAAACTTCGGCCTTTATTTTGCGAGAGAGATACTGGAGGATTGCCAACGAAACCGGA
GGTCACGGTTCAGGGCCGAGAACCCAGTGTTTCGGAAGCAGACCGTTCACGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR209741 representing NM_010368
Red=Cloning site Green=Tags(s)

MSLKWSACWVALGQLLCSCALALKGGMLFPKESPSRELKALDGLWHFRADLSNNRLQGFEQQWYRQPLRE
SGPVLDMPVPSSFNDITQEAALRDFIGWVWYEREAILPRRWTQDTDMRVVLRINSAHYYAVVWVNGIHVV
EHEGGHLPFEADISKLVQSGPLTTCRITIAINNTLTPHTLPPGTIVYKTDTSMYPKGYFVQDTSFDFFNY
AGLHRSVVLYTTPTTYIDDITVITNVEQDIGLVTYWISVQGSEHFQLEVQLLDEGGKVVAHGTGNQGQLQ
VPSANLWWPYLMHEHPAYMYSLEVKVTTTESVTDYYTLPIGIRTVAVTKSKFLINGKPFYFQGVNKHEDS
DIRGKGFDWPLLVKDFNLLRWLGANSFRTSHYPYSEEVLQLCDRYGIVVIDECPGVGIVLPQSFGNESLR
HHLEVMEELVRRDKNHPAVVMWSVANEPSSALKPAAYYFKTLITHTKALDLTRPVTFVSNAKYDADLGAP
YVDVICVNSYFSWYHDYGHLEVIQPQLNSQFENWYKTHQKPIIQSEYGADAIPGIHEDPPRMFSEEYQKA
VLENYHSVLDQKRKEYVVGELIWNFADFMTNQSPLRVIGNKKGIFTRQRQPKTSAFILRERYWRIANETG
GHGSGPRTQCFGSRPFTF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010368
ORF Size 1944 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010368.1, NP_034498
RefSeq Size 2456
RefSeq ORF 1947
Locus ID 110006
Cytogenetics 5 G1.3|5 68.32 cM
MW 74.6 kDa
Gene Summary Plays an important role in the degradation of dermatan and keratan sulfates. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)