Cnr1 (NM_007726) Mouse Tagged ORF Clone

CAT#: MR207569

Cnr1 (Myc-DDK-tagged) - Mouse cannabinoid receptor 1 (brain) (Cnr1)

Product Images

Circular map for MR207569

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Cnr1
• Synonyms: CB-R; CB1; CB1R
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR207569 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAGTCGATCTTAGACGGCCTTGCAGATACCACCTTCCGTACCATCACCACAGACCTCCTCTACGTGG
  GCTCAAATGACATTCAGTACGAAGATATCAAAGGAGACATGGCATCCAAATTAGGATACTTCCCACAGAA
  ATTCCCTCTAACTTCCTTCAGGGGTAGTCCCTTCCAAGAAAAGATGACGGCAGGAGACAACTCCCCGTTG
  GTTCCAGCAGGAGACACAACCAACATTACAGAGTTCTATAACAAGTCTCTCTCATCGTTCAAGGAGAACG
  AGGACAACATCCAGTGTGGGGAGAATTTTATGGACATGGAGTGCTTCATGATTCTGAATCCCAGCCAGCA
  GCTGGCCATCGCTGTCCTGTCCCTCACCCTGGGCACCTTCACGGTTCTGGAGAACCTGCTGGTGCTATGT
  GTCATCCTTCACTCCCGCAGTCTCCGATGCAGGCCTTCCTACCACTTCATTGGCAGCCTGGCGGTGGCCG
  ATCTCCTGGGAAGTGTCATCTTTGTCTACAGCTTTGTTGACTTCCACGTGTTCCACCGCAAAGATAGTCC
  CAATGTGTTTCTGTTCAAACTGGGTGGGGTTACCGCCTCCTTCACAGCATCTGTGGGCAGCCTGTTCCTC
  ACGGCCATCGACAGGTACATATCCATTCACAGGCCTCTGGCCTATAAGAGGATCGTCACCAGGCCCAAGG
  CCGTAGTGGCCTTTTGCTTGATGTGGACTATTGCAATAGTAATTGCTGTGTTGCCTCTCCTGGGCTGGAA
  CTGCAAGAAGCTGCAATCTGTTTGCTCAGACATCTTCCCACTCATTGATGAAACCTACCTGATGTTCTGG
  ATCGGAGTCACCAGTGTGCTGTTGCTGTTCATTGTGTATGCATACATGTACATTCTCTGGAAGGCTCACA
  GCCACGCAGTTCGCATGATCCAGCGTGGAACCCAGAAAAGCATCATCATTCACACCTCAGAAGATGGCAA
  GGTGCAGGTGACACGGCCTGACCAAGCCCGCATGGACATTAGGCTGGCCAAAACCCTGGTTCTGATCCTG
  GTGGTGTTGATCATCTGCTGGGGCCCTCTGCTTGCGATCATGGTGTATGATGTCTTTGGGAAGATGAACA
  AGCTTATCAAGACGGTGTTTGCCTTCTGTAGTATGCTCTGCCTGCTGAACTCCACCGTGAACCCCATCAT
  CTATGCTCTGAGGAGCAAGGACCTGAGACATGCTTTCCGCAGCATGTTCCCTTCATGTGAAGGCACTGCG
  CAGCCTCTAGATAACAGCATGGGGGACTCAGACTGCCTGCACAAGCACGCCAATAACACAGCCAGCATGC
  ACAGGGCCGCGGAAAGCTGCATCAAGAGCACTGTTAAGATCGCCAAGGTGACCATGTCTGTGTCCACAGA
  CACGTCTGCCGAGGCTCTG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR207569 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPL
  VPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLC
  VILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFL
  TAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFW
  IGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLIL
  VVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTA
  QPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_007726
• ORF Size: 1422 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_007726.5
• RefSeq Size: 5807 bp
• RefSeq ORF: 1422 bp
• Locus ID: 12801
• UniProt ID: P47746
• Cytogenetics: 4 16.28 cM
• MW: 52.8 kDa
• Gene Summary: G-protein coupled receptor for cannabinoids, including endocannabinoids (eCBs), such as N-arachidonoylethanolamide (also called anandamide or AEA) and 2-arachidonoylglycerol (2-AG) (PubMed:9888857, PubMed:22388959). Mediates many cannabinoid-induced effects, acting, among others, on food intake, memory loss, gastrointestinal motility, catalepsy, ambulatory activity, anxiety, chronic pain (PubMed:9888857, PubMed:27828947). Signaling typically involves reduction in cyclic AMP (PubMed:8832654, PubMed:27828947). Signaling typically involves reduction in cyclic AMP (By similarity). In the hypothalamus, may have a dual effect on mitochondrial respiration depending upon the agonist dose and possibly upon the cell type. Increases respiration at low doses, while decreases respiration at high doses (PubMed:25707796, PubMed:27828947). At high doses, CNR1 signal transduction involves G-protein alpha-i protein activation and subsequent inhibition of mitochondrial soluble adenylate cyclase, decrease in cyclic AMP concentration, inhibition of protein kinase A (PKA)-dependent phosphorylation of specific subunits of the mitochondrial electron transport system, including NDUFS2 (PubMed:27828947). In the hypothalamus, inhibits leptin-induced reactive oxygen species (ROS) formation and mediates cannabinoid-induced increase in SREBF1 and FASN gene expression (PubMed:25869131). In response to cannabinoids, drives the release of orexigenic beta-endorphin, but not that of melanocyte-stimulating hormone alpha/alpha-MSH, from hypothalamic POMC neurons, hence promoting food intake (PubMed:25707796). In the hippocampus, regulates cellular respiration and energy production in response to cannabinoids. Involved in cannabinoid-dependent depolarization-induced suppression of inhibition (DSI), a process in which depolarization of CA1 postsynaptic pyramidal neurons mobilizes eCBs, which retrogradely activate presynaptic CB1 receptors, transiently decreasing GABAergic inhibitory neurotransmission (PubMed:22388959). Also reduces excitatory synaptic transmission (PubMed:27828947). In superior cervical ganglions and cerebral vascular smooth muscle cells, inhibits voltage-gated Ca(2+) channels in a constitutive, as well as agonist-dependent manner (By similarity). In cerebral vascular smooth muscle cells, cannabinoid-induced inhibition of voltage-gated Ca(2+) channels leads to vasodilation and decreased vascular tone (By similarity). Induces leptin production in adipocytes and reduces LRP2-mediated leptin clearance in the kidney, hence participating in hyperleptinemia (PubMed:22841573). In adipose tissue, CNR1 signaling leads to increased expression of SREBF1, ACACA and FASN genes (PubMed:15864349). In the liver, activation by endocannabinoids leads to increased de novo lipogenesis and reduced fatty acid catabolism, associated with increased expression of SREBF1/SREBP-1, GCK, ACACA, ACACB and FASN genes (PubMed:15864349, PubMed:21987372). May also affect de novo cholesterol synthesis and HDL-cholesteryl ether uptake (PubMed:21987372). Peripherally modulates energy metabolism. In high carbohydrate diet-induced obesity, may decrease the expression of mitochondrial dihydrolipoyl dehydrogenase/DLD in striated muscles, as well as that of selected glucose/ pyruvate metabolic enzymes, hence affecting energy expenditure through mitochondrial metabolism (PubMed:26671069). In response to cannabinoid anandamide, elicits a proinflammatory response in macrophages, which involves NLRP3 inflammasome activation and IL1B and IL18 secretion. In macrophages infiltrating pancreatic islets, this process may participate in the progression of type-2 diabetes and associated loss of pancreatic beta-cells (PubMed:23955712).[UniProtKB/Swiss-Prot Function]