Pold3 (NM_133692) Mouse Tagged ORF Clone

CAT#: MR207366

  • TrueORF®

Pold3 (Myc-DDK-tagged) - Mouse polymerase (DNA-directed), delta 3, accessory subunit (Pold3)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_133692" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Pold3"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Pold3
Synonyms 2410142G14Rik; C85233; P66; P68
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR207366 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAACAGCTGTATCTAGAAAACATAGACGAGTTCGTCACGGACCAGAACAAGATCGTGACTTACA
AGTGGCTAAGCTATACACTAGGGGTTCATGTTAACCAGGCCAAACAGATGCTCTATGAATATGTTGAAAG
GAAACGGAAAGAAAATTCGGGAGCTCAGCTGCATGTTACCTACTTGGTGTCTGGCAGTCTTATACAGAAC
GGACATTCTTGCCACAAGGTTGCAGTAGTGAGAGAAGATAAACTGGAAGCAGTGAAGTCCAAGTTAGCTG
TGACTGCCAGCATCCATGTGTACAGCATCCAGAAAGCTATGCTAAAGGACAGTGGGCCTCTGTTCAATAC
CGACTATGACATCCTTAAAAGCAATTTGCAGAACTGCAGCAAGTTTAGTGCCATACAGTGTGCAGCTGCA
GTCCCCAGAGCTCCTGCAGAATCCCCATCTTCCAGAAAGTATGAACAGTCAAATCTTCAGGCAGCGAGTG
AGGCACAAGCCAGTGAGCTGACTACCAATGGCCATGGTCCACCTGCCTCCAAACAGGCTTCCCAGCAGCC
CAAAGGAATTATGGGAATGTTAATCTCTAAAGCTGCTACTAAAACCCAGGACACCAACAAGGAAACCAAA
CCAGAGGCCCGAGAAGTAACCAGTGCATCTTCTGCTGGGGGCAAAGCACCAGGAAAAGGGAGTGTGATGA
GCAACTTTTTTGGAAAAGCTGCAATGAATAAACTTAAAGTCAATTTGGATTCAGAACAAGCAGTAAAGGA
AGAAAAAACAGTGGAGCAACCTCCAGTGTCTGTCACTGAACCAAAGCTGGCAGCTCCCCCAGCTCAGAAG
AAATCCAGCAGAAAGTCCGAGCCTGGGAAGGTGCAGCAGAAGGAGAAAAGCAGGGGCAAGCGAGTAGACT
TGTCGGATGAGGAGGCAAAGGAAACCGAACACCTGAAGAAAAAGAGAAGAAGAATCAAGCTTCCTCAGTC
TGATAGCAGTGAAGATGAAGTCTTCGAAGACTCCCCTGAGATGTATGAAGCAGACTCACCATCTCCACCT
CCTGTATCTCCACCTCCTGATCCTATGCCAAAAACTGAGCCCCCTCCTGTCAAGCGTTCAAGTGGAGAAA
CCAAAAGGAGACGAAAGCGTGTACTGAAATCTAAAACCTTTGTGGATGAAGAAGGCTGCATAGTGACTGA
GAAAGTCTATGAGAGTGAGTCCTGCACAGACAGTGAGGAGGAGCTTAAGATGAAGCCGGCCTCAGCACAC
AAACCCCCTGCTGCCGCTGTGAAAAGGGAGCCCAGAGAAGAACGGAAGGGCCCCAAGAAAGGGGCTGCTG
CTCTGGGCAAAGCCAACAGACAAGTGTCCATTACTGGCTTCTTCCAGAAAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR207366 protein sequence
Red=Cloning site Green=Tags(s)

MAEQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYEYVERKRKENSGAQLHVTYLVSGSLIQN
GHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAA
VPRAPAESPSSRKYEQSNLQAASEAQASELTTNGHGPPASKQASQQPKGIMGMLISKAATKTQDTNKETK
PEAREVTSASSAGGKAPGKGSVMSNFFGKAAMNKLKVNLDSEQAVKEEKTVEQPPVSVTEPKLAAPPAQK
KSSRKSEPGKVQQKEKSRGKRVDLSDEEAKETEHLKKKRRRIKLPQSDSSEDEVFEDSPEMYEADSPSPP
PVSPPPDPMPKTEPPPVKRSSGETKRRRKRVLKSKTFVDEEGCIVTEKVYESESCTDSEEELKMKPASAH
KPPAAAVKREPREERKGPKKGAAALGKANRQVSITGFFQKK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_133692
ORF Size 1386 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_133692.2, NP_598453.1
RefSeq Size 3002 bp
RefSeq ORF 1386 bp
Locus ID 67967
Cytogenetics 7 E2
MW 50.7 kDa
Gene Summary As a component of the trimeric and tetrameric DNA polymerase delta complexes (Pol-delta3 and Pol-delta4, respectively), plays a role in high fidelity genome replication, including in lagging strand synthesis, and repair (PubMed:10219083, PubMed:27524497). Required for optimal Pol-delta activity. Stabilizes the Pol-delta complex and plays a major role in Pol-delta stimulation by PCNA. Pol-delta3 and Pol-delta4 are characterized by the absence or the presence of POLD4. They exhibit differences in catalytic activity. Most notably, Pol-delta3 shows higher proofreading activity than Pol-delta4. Although both Pol-delta3 and Pol-delta4 process Okazaki fragments in vitro, Pol-delta3 may also be better suited to fulfill this task, exhibiting near-absence of strand displacement activity compared to Pol-delta4 and stalling on encounter with the 5'-blocking oligonucleotides. Pol-delta3 idling process may avoid the formation of a gap, while maintaining a nick that can be readily ligated. Along with DNA polymerase kappa, DNA polymerase delta carries out approximately half of nucleotide excision repair (NER) synthesis following UV irradiation. In this context, POLD3, along with PCNA and RFC1-replication factor C complex, is required to recruit POLD1, the catalytic subunit of the polymerase delta complex, to DNA damage sites. Under conditions of DNA replication stress, required for the repair of broken replication forks through break-induced replication (BIR). Involved in the translesion synthesis (TLS) of templates carrying O6-methylguanine or abasic sites performed by Pol-delta4, independently of DNA polymerase zeta (REV3L) or eta (POLH). Facilitates abasic site bypass by DNA polymerase delta by promoting extension from the nucleotide inserted opposite the lesion. Also involved in TLS, as a component of the POLZ complex. Along with POLD2, dramatically increases the efficiency and processivity of DNA synthesis of the minimal DNA polymerase zeta complex, consisting of only REV3L and REV7 (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.