Arih1 (NM_019927) Mouse Tagged ORF Clone

CAT#: MR207099

Arih1 (Myc-DDK-tagged) - Mouse ariadne ubiquitin-conjugating enzyme E2 binding protein homolog 1 (Drosophila) (Arih1)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 419.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Arih1 (NM_019927) Mouse Tagged ORF Clone
Symbol Arih1
Synonyms Ari; Ari1; AU021774; Hari; Hhari; Ubch7bp; Uip77
Vector pCMV6-Entry
Sequence Data
>MR207099 representing NM_019927
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGAATGTATCCGGGAGGTCAACGAGGTCATCCAGAATCCAGCAACTATCACGAGAATACTCCTTA
GCCACTTCAATTGGGATAAAGAGAAGCTAATGGAAAGGTACTTTGATGGAAACCTGGAGAAGCTCTTTGC
TGAGTGTCATGTAATTAATCCAAGTAAAAAGTCTCGAACTCGCCAGATGAATACAAGGTCATCGGCACAG
GATATGCCGTGTCAGATCTGCTACTTGAACTACCCTAACTCGTATTTTACTGGCCTTGAATGTGGACATA
AGTTTTGTATGCAGTGCTGGAGTGAATATTTAACTACAAAAATAATGGAGGAAGGCATGGGGCAGACTAT
TTCGTGTCCTGCGCATGGTTGTGATATCTTAGTGGATGACAACACAGTTATGCGCCTGATCACAGATTCC
AAAGTTAAGTTAAAATATCAACATTTAATAACAAATAGCTTTGTAGAGTGCAACCGACTGTTAAAGTGGT
GTCCTGCCCCAGATTGCCACCATGTTGTTAAAGTCCAGTATCCTGATGCAAAACCAGTTCGCTGCAAATG
TGGCCGCCAGTTTTGCTTTAACTGTGGTGAAAATTGGCATGATCCAGTTAAATGTAAGTGGTTGAAGAAG
TGGATTAAAAAGTGTGATGATGACAGTGAAACTTCTAATTGGATTGCAGCTAACACAAAGGAATGTCCCA
AATGCCATGTCACAATTGAGAAGGATGGCGGTTGTAATCACATGGTCTGTCGTAACCAGAACTGTAAAGC
AGAATTTTGCTGGGTGTGTCTTGGCCCTTGGGAACCGCATGGATCTGCCTGGTACAACTGTAACCGCTAT
AATGAGGATGATGCAAAGGCAGCAAGAGATGCCCAAGAGCGATCTAGGGCGGCCCTGCAGAGATACCTGT
TCTACTGTAATCGCTATATGAACCACATGCAGAGTCTACGCTTCGAGCATAAGCTGTATGCTCAGGTGAA
ACAGAAGATGGAGGAGATGCAGCAGCACAACATGTCCTGGATCGAGGTGCAGTTCCTGAAGAAAGCAGTT
GATGTCCTCTGCCAGTGTCGTGCCACACTCATGTACACTTATGTCTTCGCTTTCTACCTCAAAAAGAATA
ACCAGTCCATTATCTTTGAGAATAATCAAGCAGATCTAGAAAATGCCACAGAGGTGCTTTCGGGCTACCT
TGAACGAGATATTTCCCAAGATTCTCTGCAAGATATAAAGCAGAAAGTCCAAGATAAGTACAGATACTGT
GAGAGTCGACGAAGGGTTTTGTTACAGCATGTGCATGAAGGCTATGAAAAAGATCTGTGGGAGTACATTG
AGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR207099 representing NM_019927
Red=Cloning site Green=Tags(s)

MVECIREVNEVIQNPATITRILLSHFNWDKEKLMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRSSAQ
DMPCQICYLNYPNSYFTGLECGHKFCMQCWSEYLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLITDS
KVKLKYQHLITNSFVECNRLLKWCPAPDCHHVVKVQYPDAKPVRCKCGRQFCFNCGENWHDPVKCKWLKK
WIKKCDDDSETSNWIAANTKECPKCHVTIEKDGGCNHMVCRNQNCKAEFCWVCLGPWEPHGSAWYNCNRY
NEDDAKAARDAQERSRAALQRYLFYCNRYMNHMQSLRFEHKLYAQVKQKMEEMQQHNMSWIEVQFLKKAV
DVLCQCRATLMYTYVFAFYLKKNNQSIIFENNQADLENATEVLSGYLERDISQDSLQDIKQKVQDKYRYC
ESRRRVLLQHVHEGYEKDLWEYIED

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_019927
ORF Size 1335 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_019927.1, NP_064311
RefSeq Size 6435
RefSeq ORF 1668
Locus ID 23806
Cytogenetics 9|9 B
MW 64.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)