Kcnab2 (NM_010598) Mouse Tagged ORF Clone

CAT#: MR205641

  • TrueORF®

Kcnab2 (Myc-DDK-tagged) - Mouse potassium voltage-gated channel, shaker-related subfamily, beta member 2 (Kcnab2)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_010598" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 686.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Mouse Monoclonal anti-KCNA2B Antibody
    • 100 ug

USD 570.00

Other products for "Kcnab2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Kcnab2
Synonyms F5; I2rf5; Kcnb3; kv-beta-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR205641 representing NM_010598
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTATCCGGAATCAACCACGGGGTCCCCAGCTCGACTCTCCCTGCGGCAGACAGGCTCCCCCGGGATGA
TCTACAGTACTCGTTATGGGAGTCCCAAAAGACAGCTCCAGTTTTACAGGAATCTGGGCAAATCTGGCCT
TCGGGTCTCCTGCCTGGGGCTTGGAACATGGGTGACCTTCGGGGGCCAGATCACGGATGAGATGGCAGAG
CACCTAATGACCTTGGCCTACGATAATGGCATCAACCTGTTCGATACGGCGGAGGTCTACGCTGCTGGAA
AAGCTGAAGTGGTATTAGGGAACATCATTAAGAAGAAGGGATGGAGACGGTCCAGCCTTGTCATCACCAC
CAAGATCTTCTGGGGTGGAAAAGCGGAGACTGAGAGAGGCCTTTCCAGGAAGCACATAATTGAAGGACTG
AAAGCGTCCCTGGAGCGGCTGCAGCTGGAGTACGTGGATGTGGTTTTTGCCAACCGCCCAGACCCCAACA
CGCCCATGGAAGAGACCGTGCGGGCCATGACCCATGTCATCAACCAGGGGATGGCCATGTACTGGGGCAC
ATCACGCTGGAGCTCCATGGAGATCATGGAGGCCTACTCGGTGGCTCGGCAGTTCAACCTGATCCCGCCC
ATCTGCGAGCAAGCGGAATATCACATGTTCCAGAGGGAGAAGGTGGAGGTCCAGCTGCCAGAGCTGTTCC
ACAAGATAGGAGTAGGTGCCATGACCTGGTCCCCTCTGGCGTGCGGCATCGTCTCAGGGAAGTATGACAG
CGGGATCCCACCCTACTCCAGAGCCTCCCTGAAGGGCTACCAGTGGTTGAAGGACAAGATCCTGAGTGAG
GAGGGTCGCCGCCAGCAGGCCAAGCTGAAGGAACTGCAGGCCATTGCCGAACGCCTGGGCTGCACCCTAC
CCCAGCTGGCCATAGCCTGGTGCCTGAGGAATGAGGGTGTCAGCTCCGTGCTTCTGGGTGCTTCCAATGC
AGAACAACTTATGGAGAACATTGGAGCAATACAGGTCCTTCCAAAATTGTCGTCTTCCATCGTCCACGAG
ATCGACAGCATTCTGGGCAATAAACCCTACAGCAAAAAGGACTATAGATCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205641 representing NM_010598
Red=Cloning site Green=Tags(s)

MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAE
HLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGL
KASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPP
ICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSE
EGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHE
IDSILGNKPYSKKDYRS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_010598
ORF Size 1101 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_010598.4
RefSeq Size 3571 bp
RefSeq ORF 1104 bp
Locus ID 16498
UniProt ID P62482
Cytogenetics 4 83.08 cM
MW 41.5 kDa
Gene Summary Cytoplasmic potassium channel subunit that modulates the characteristics of the channel-forming alpha-subunits (PubMed:8576199). Contributes to the regulation of nerve signaling, and prevents neuronal hyperexcitability (PubMed:11825900, PubMed:21209188). Promotes expression of the pore-forming alpha subunits at the cell membrane, and thereby increases channel activity (By similarity). Promotes potassium channel closure via a mechanism that does not involve physical obstruction of the channel pore (PubMed:8576199). Modulates the functional properties of KCNA4 (By similarity). Modulates the functional properties of KCNA5 (PubMed:8576199). Enhances KCNB2 channel activity (PubMed:8824288). Modulates the functional properties of KCNA5 (PubMed:8576199). Binds NADPH and has NADPH-dependent aldoketoreductase activity (By similarity). Has broad substrate specificity and can catalyze the reduction of methylglyoxal, 9,10-phenanthrenequinone, prostaglandin J2, 4-nitrobenzaldehyde, 4-nitroacetophenone and 4-oxo-trans-2-nonenal (in vitro) (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.