Wnt7a (NM_009527) Mouse Tagged ORF Clone

CAT#: MR205285

Wnt7a (Myc-DDK-tagged) - Mouse wingless-related MMTV integration site 7A (Wnt7a)

Product Images

Circular map for MR205285

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Wnt7a
• Synonyms: AI849442; px; tw; Wnt-7a
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR205285 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGACCCGGAAAGCGCGGCGCTGCCTGGGCCACCTCTTTCTCAGCCTGGGCATAGTCTACCTCCGGATCG
  GTGGCTTCTCTTCGGTGGTAGCTCTGGGTGCGAGCATCATCTGTAACAAGATCCCAGGCCTGGCTCCCAG
  ACAGCGGGCAATCTGCCAGAGCCGGCCGGACGCCATCATCGTCATAGGAGAAGGCTCCCAAATGGGCCTG
  GACGAGTGTCAGTTTCAGTTCCGAAATGGCCGTTGGAACTGCTCAGCGCTGGGAGAGCGTACTGTCTTCG
  GGAAGGAGCTCAAAGTGGGGAGTCGGGAGGCTGCCTTCACCTATGCGATTATCGCTGCGGGCGTGGCCCA
  TGCCATCACTGCTGCCTGCACCCAGGGCAACCTGAGCGACTGTGGCTGCGACAAGGAGAAGCAAGGCCAG
  TACCACCGGGACGAGGGCTGGAAGTGGGGTGGCTGCTCTGCCGACATCCGCTACGGCATCGGCTTCGCCA
  AGGTCTTCGTGGATGCCCGGGAGATCAAGCAGAATGCCCGGACGCTCATGAACTTACACAATAACGAGGC
  GGGTCGGAAGATCCTGGAGGAGAACATGAAGCTGGAGTGTAAGTGCCATGGTGTGTCAGGCTCCTGTACC
  ACTAAGACGTGCTGGACCACACTGCCACAGTTCCGAGAGCTAGGCTACGTGCTCAAGGACAAATACAACG
  AGGCCGTCCACGTGGAGCCTGTGCGTGCCAGTCGAAACAAGCGGCCCACCTTTCTGAAGATCAAGAAGCC
  CCTGTCCTACCGCAAGCCCATGGACACTGACCTGGTGTATATCGAGAAGTCACCCAATTACTGTGAAGAG
  GACCCAGTGACAGGCAGCGTGGGTACCCAGGGCCGAGCCTGCAATAAGACAGCCCCTCAGGCCAGTGGCT
  GTGACCTCATGTGCTGTGGCCGTGGCTACAACACACACCAGTACGCCCGGGTGTGGCAGTGCAACTGCAA
  ATTCCACTGGTGCTGCTACGTCAAGTGTAACACGTGCAGCGAGCGCACGGAGATGTATACGTGCAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR205285 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTRKARRCLGHLFLSLGIVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGL
  DECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQ
  YHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCT
  TKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEE
  DPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_009527
• ORF Size: 1050 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_009527.4
• RefSeq Size: 3176 bp
• RefSeq ORF: 1050 bp
• Locus ID: 22421
• UniProt ID: P24383
• Cytogenetics: 6 40.45 cM
• MW: 39 kDa
• Gene Summary: Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta-catenin signaling pathway (PubMed:18230341, PubMed:20530549, PubMed:23629626). Plays an important role in embryonic development, including dorsal versus ventral patterning during limb development, skeleton development and urogenital tract development (PubMed:7885472, PubMed:9769174, PubMed:9790192). Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation (PubMed:28803732). Required for normal, sexually dimorphic development of the Mullerian ducts, and for normal fertility in both sexes (PubMed:9790192). Required for normal neural stem cell proliferation in the hippocampus dentate gyrus (PubMed:23629626). Required for normal progress through the cell cycle in neural progenitor cells, for self-renewal of neural stem cells, and for normal neuronal differentiation and maturation (PubMed:23629626). Promotes formation of synapses via its interaction with FZD5 (PubMed:20530549).[UniProtKB/Swiss-Prot Function]