Polr2e (NM_025554) Mouse Tagged ORF Clone

CAT#: MR202269

Polr2e (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide E (Polr2e)

Product Images

Circular map for MR202269

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Polr2e
• Synonyms: 25kDa; 2410021N14Rik; AW208866; RPB5; XAP4
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR202269 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGACGACGAGGAGGAGACCTACCGGCTGTGGAAGATCCGCAAGACGATCATGCAGCTGTGTCATGACC
  GTGGCTACCTGGTGACCCAGGATGAACTGGACCAGACACTTGAGGAATTCAAGGCGCAGTTTGGGGACAA
  GCCCAGCGAAGGACGGCCAAGGCGCACAGACCTCACGGTGCTGGTGGCCCACAACGATGACCCCACAGAC
  CAGATGTTTGTGTTCTTCCCAGAGGAGCCCAAGGTGGGCATCAAGACCATCAAGGTATACTGCCAGCGCA
  TGCAGGAGGAAAACATCACACGGGCGCTGATTGTGGTGCAGCAGGGCATGACGCCCTCCGCCAAGCAGTC
  CCTGGTGGACATGGCCCCGAAGTATGTGCTGGAACAGTTTCTACAGCAGGAGCTGCTCATCAATATCACA
  GAGCACGAGCTAGTCCCTGAGCACGTGGTCATGACAAAGGAGGAGGTGACTGAACTGCTGGCTCGATACA
  AGCTTCGTGAGAGCCAGCTACCCAGAATCCAGGCCGGGGACCCAGTGGCACGGTACTTTGGGATCAAGCG
  AGGGCAGGTCGTGAAGATCATCCGCCCCAGTGAGACGGCTGGCCGCTACATCACCTACCGCCTGGTGCAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR202269 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTVLVAHNDDPTD
  QMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVDMAPKYVLEQFLQQELLINIT
  EHELVPEHVVMTKEEVTELLARYKLRESQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRYITYRLVQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_025554
• ORF Size: 633 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_025554.2, NP_079830.2
• RefSeq Size: 1022 bp
• RefSeq ORF: 633 bp
• Locus ID: 66420
• UniProt ID: Q80UW8
• Cytogenetics: 10 C1
• MW: 24.6 kDa
• Gene Summary: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2E/RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).[UniProtKB/Swiss-Prot Function]