Cbln4 (NM_175631) Mouse Tagged ORF Clone

CAT#: MR201963

Cbln4 (Myc-DDK-tagged) - Mouse cerebellin 4 precursor protein (Cbln4)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cbln4 (NM_175631) Mouse Tagged ORF Clone
Symbol Cbln4
Synonyms AI848962
Vector pCMV6-Entry
Sequence Data
>MR201963 representing NM_175631
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTCCGCGCGCCGGGCGCTGTCCGTGGTACCAGCCGTTCTGCTGATTCTAGTGCTGCCTGTCTGGG
CACAGAATGACACGGAACCGATCGTTCTGGAGGGCAAGTGTCTGGTGGTGTGCGACTCGAACCCAGCTAC
AGACTCCAAGGGATCATCATCTTCCCCTCTGGGGATATCGGTCCGGGCAGCAAACTCCAAGGTGGCTTTT
TCGGCGGTTCGGAGCACCAACCACGAGCCATCTGAGATGAGCAACAAGACTCGCATCATTTACTTTGATC
AGATCCTGGTTAACGTGGGTAATTTTTTCACATTGGAATCTGTCTTTGTGGCACCGAGGAAAGGAATCTA
TAGTTTCAGTTTTCACGTAATTAAAGTCTACCAGAGCCAAACCATCCAGGTTAACTTGATGTTAAATGGA
AAACCAGTCATCTCTGCATTTGCTGGTGATAAAGATGTGACCCGTGAAGCCGCCACTAATGGAGTGCTCC
TGTACCTGGACAAAGAAGATAAGGTCTACCTAAAACTGGAGAAAGGTAACTTGCTCGGTGGCTGGCAGTA
TTCCACGTTTTCTGGCTTTCTGGTGTTTCCTCTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201963 representing NM_175631
Red=Cloning site Green=Tags(s)

MGSARRALSVVPAVLLILVLPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPLGISVRAANSKVAF
SAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNG
KPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLEKGNLLGGWQYSTFSGFLVFPL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_175631
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_175631.1, NM_175631.2, NM_175631.3, NP_783439
RefSeq Size 2802
RefSeq ORF 597
Locus ID 228942
Cytogenetics 2|2 H3
MW 22.1 kDa
Gene Summary May be involved in synaptic functions in the CNS. May play a role in CBLN3 export from the endoplasmic reticulum and secretion. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)