Eif3s12 (BC027638) Mouse Tagged ORF Clone

CAT#: MR201715

Eif3s12 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 3, subunit 12 (cDNA clone MGC:41262 IMAGE:1348838)

Product Images

Circular map for MR201715

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Eif3s12
• Synonyms: eIF3K
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR201715 representing BC027638
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCGATGTTTGAGCAGATGAGAGCGAACGTGGGCAAGTTGCTCAAGGGTATCGACAGGTACCAGTTCA
  ACCCAGCCTTCTTCCAGACCACAGTCACTGCCCAGATTCTGCTGAAAGCCCTCACCAACCTGCCCCACAC
  CGACTTCACTCTGTGTAAATGTATGATCGACCAGGCACATCAAGAAGAGCGGCCCATCCGGCAGATCTTG
  TACCTCGGGGACCTGCTGGAGACCTGCCACTTTCAAGCCTTCTGGCAAGCCCTGGATGAGAACATGGACC
  TTCTGGAAGGCATAACTGGCTTTGAAGACTCTGTCCGAAAATTTATCTGCCACGTGGTGGGCATCACGTA
  CCAGCACATCGACCGCTGGCTGCTGGCCGAGATGCTCGGAGACCTGACTGACAACCAGCTGAAGGTGTGG
  ATGAGCAAGTACGGCTGGAGCGCTGACGAGTCAGGGCAGGTCTTCATCTGCAGCCAGGAAGAGAGCATTA
  AGCCCAAGAACATCGTGGAGAAGATTGACTTTGACAGTGTGTCCAGCATCATGGCCTCCTCCCAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR201715 representing BC027638
  Red=Cloning site Green=Tags(s)
  
  MAMFEQMRANVGKLLKGIDRYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQIL
  YLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDNQLKVW
  MSKYGWSADESGQVFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC027638
• ORF Size: 555 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: BC027638.1
• RefSeq Size: 670 bp
• RefSeq ORF: 557 bp
• Locus ID: 73830
• Cytogenetics: 7 B1
• MW: 24.5 kDa
• Gene Summary: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.[UniProtKB/Swiss-Prot Function]