Timm8a1 (NM_013898) Mouse Tagged ORF Clone
CAT#: MR200281
- TrueORF®
Timm8a1 (Myc-DDK-tagged) - Mouse translocase of inner mitochondrial membrane 8 homolog a1 (yeast) (Timm8a1), nuclear gene encoding mitochondrial protein
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_013898" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Timm8a1 |
Synonyms | Ddp1; DXHXS1274E; Fci-12; Tim8a; Timm8a |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200281 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGTCCTCCACGTCCTCTTCGGGCTCGGCTCTGGGCGCGGTGGACCCTCAGTTGCAGCATTTCATCG AGGTGGAGACGCAGAAGCAGCGCTTCCAGCAGCTGGTGCACCAGATGACGGAACTTTGCTGGGAGAAGTG CATGGATAAGCCTGGGCCTAAGTTGGACAGTCGGGCTGAGGCCTGTTTTGTGAACTGCGTTGAACGCTTC ATTGATACAAGCCAATTCATCTTAAATCGACTGGAACAGACCCAGAAGTCCAAACCCGTCTTCTCAGAAA GCCTTTCTGAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200281 protein sequence
Red=Cloning site Green=Tags(s) MESSTSSSGSALGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERF IDTSQFILNRLEQTQKSKPVFSESLSD myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_013898 |
ORF Size | 294 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_013898.1, NM_013898.2, NM_013898.3, NP_038926.1 |
RefSeq Size | 1195 bp |
RefSeq ORF | 294 bp |
Locus ID | 30058 |
UniProt ID | Q9WVA2 |
Cytogenetics | X 56.18 cM |
MW | 11 kDa |
Gene Summary | Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC207479 | Timm8a1 (untagged) - Mouse translocase of inner mitochondrial membrane 8 homolog a1 (yeast) (Timm8a1), nuclear gene encoding mitochondrial protein, (10ug) |
USD 165.00 |
|
MG200281 | Timm8a1 (tGFP-tagged) - Mouse translocase of inner mitochondrial membrane 8 homolog a1 (yeast) (Timm8a1) |
USD 350.00 |
|
MR200281L3 | Lenti ORF clone of Timm8a1 (Myc-DDK-tagged) - Mouse translocase of inner mitochondrial membrane 8 homolog a1 (yeast) (Timm8a1), nuclear gene encoding mitochondrial protein |
USD 450.00 |
|
MR200281L4 | Lenti ORF clone of Timm8a1 (mGFP-tagged) - Mouse translocase of inner mitochondrial membrane 8 homolog a1 (yeast) (Timm8a1), nuclear gene encoding mitochondrial protein |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review