Gtf2h5 (NM_181392) Mouse Tagged ORF Clone
CAT#: MR200081
- TrueORF®
Gtf2h5 (Myc-DDK-tagged) - Mouse general transcription factor IIH, polypeptide 5 (Gtf2h5)
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_181392" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Gtf2h5 |
Synonyms | 2700017P07Rik; 2810432H05Rik; D17Wsu155e |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200081 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTCAACGTGCTGAAAGGGGTGCTTATAGAATGTGACCCTGCCATGAAGCAGTTCTTGCTGTACTTGG ATGAGGCCAACGCCTTGGGGAAGAAGTTCATCATTCAGGACATTGATGACACGCACGTCTTCGTCATTGC CGAGCTGGTCAACGTCCTCCAGGAGCGAGTAGGGGAACTGATGGACCAGAATGCCTTTTCTCTTACCCAG AAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200081 protein sequence
Red=Cloning site Green=Tags(s) MVNVLKGVLIECDPAMKQFLLYLDEANALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFSLTQ K myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_181392 |
ORF Size | 216 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_181392.3 |
RefSeq Size | 1191 bp |
RefSeq ORF | 216 bp |
Locus ID | 66467 |
UniProt ID | Q8K2X8 |
Cytogenetics | 17 3.7 cM |
MW | 8 kDa |
Gene Summary | Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC202230 | Gtf2h5 (untagged) - Mouse general transcription factor IIH, polypeptide 5 (Gtf2h5), (10ug) |
USD 150.00 |
|
MG200081 | Gtf2h5 (tGFP-tagged) - Mouse general transcription factor IIH, polypeptide 5 (Gtf2h5) |
USD 350.00 |
|
MR200081L3 | Lenti ORF clone of Gtf2h5 (Myc-DDK-tagged) - Mouse general transcription factor IIH, polypeptide 5 (Gtf2h5) |
USD 450.00 |
|
MR200081L4 | Lenti ORF clone of Gtf2h5 (mGFP-tagged) - Mouse general transcription factor IIH, polypeptide 5 (Gtf2h5) |
USD 450.00 |
{0} Product Review(s)
Be the first one to submit a review