TRIO Rabbit Polyclonal Antibody

CAT#: TA339708

Rabbit Polyclonal Anti-TRIO Antibody

Product Images

Host: Rabbit; Target Name: TRIO; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0 ug/ml TRIO is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TRIO antibody is: synthetic peptide directed towards the C-terminal region of Human TRIO. Synthetic peptide located within the following region: PGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: trio Rho guanine nucleotide exchange factor
• Database Link:
  NP_009049
  Entrez Gene 7204 Human
  UniProt ID O75962
• Background: TRIO promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could play a role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell growth.
• Synonyms: ARHGEF23; MEBAS; MRD44; tgat
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase