Germany
Japan
United Kingdom
China
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Products
View as table Download
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
USD 509.00
2 Weeks
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit anti-GADD45A Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GADD45A |
GADD45A (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human GADD45A |
Rabbit Polyclonal Anti-GADD45A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45A antibody: synthetic peptide directed towards the C terminal of human GADD45A. Synthetic peptide located within the following region: LRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPA |
GADD45A Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GADD45A |
Mouse Monoclonal GADD45a Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GADD45A mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GADD45A mouse monoclonal antibody, clone OTI2B7 (formerly 2B7)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- GADD45A
Reactivities
- Human
Families
- Druggable Genome
Pathways
- Cell cycle