GADD45A Rabbit Polyclonal Antibody

CAT#: TA342868

Rabbit Polyclonal Anti-GADD45A Antibody

Product Images

WB Suggested Anti-GADD45A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GADD45A antibody: synthetic peptide directed towards the C terminal of human GADD45A. Synthetic peptide located within the following region: LRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: growth arrest and DNA damage inducible alpha
• Database Link:
  NP_001915
  Entrez Gene 1647 Human
  UniProt ID P24522
• Background: GADD45A responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of GADD45A gene is mediated by both p53-dependent and -independent mechanisms.
• Synonyms: DDIT1; GADD45
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Rabbit: 86%; Horse: 79%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency
• Protein Pathways: Cell cycle, MAPK signaling pathway, p53 signaling pathway