Products

View as table Download

PPAT mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABAT mouse monoclonal antibody,clone UMAB178

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPAT mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ASS1 mouse monoclonal antibody,clone OTI12G1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259)

Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329)

Rabbit polyclonal anti-GAD67/GAD1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GAD67.
Modifications Phospho-specific

GAD67 (GAD1) chicken polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide KLH conjugated corresponding to a region near the C-terminus of this gene product, and was 100% conserved between the Human (Q99259), Mouse (P48318) and Rat (NP_058703) gene products.
After repeated injections into the hens, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity purified using a peptide column.

Rabbit polyclonal GOT2 Antibody (N-term)

Applications FC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Chicken, Pig, Monkey)
Conjugation Unconjugated
Immunogen This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2.

Rabbit Polyclonal Anti-GLS Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

Rabbit Polyclonal Anti-GOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GOT2 Antibody: synthetic peptide directed towards the N terminal of human GOT2. Synthetic peptide located within the following region: VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEA

GAD67 (GAD1) (+ GAD2 / GAD65) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Feline, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide sequence from the C-terminus of GAD