Rat monoclonal anti-TUBA1A(alpha Tubulin ) antibody, clone YL1/2, Loading control
Applications | ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mammalian, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
Rat monoclonal anti-TUBA1A(alpha Tubulin ) antibody, clone YL1/2, Loading control
Applications | ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mammalian, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
Tubulin (TUBA1B) (Tyr-Tubulin) rat monoclonal antibody, clone YL1/2, Purified
Applications | ELISA, IF, IHC, IP, R, WB |
Reactivities | Mammalian, Yeast, Birds |
Conjugation | Unconjugated |
Mouse Monoclonal p53 Antibody (PAb 240)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Yeast (Does not react with: Xenopus) |
Conjugation | Unconjugated |
Mouse Monoclonal PCNA Antibody (PC10)
Applications | ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
Reactivities | Chicken, Drosophila, Human, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
Tubulin (TUBA1B) rat monoclonal antibody, clone YOL1/34, Purified
Applications | ELISA, IF, IHC, IP, R, WB |
Reactivities | Human, Mammalian, Mouse, Rat, Yeast, Birds, Drosophila |
Conjugation | Unconjugated |
Mouse Monoclonal c-Myc Antibody (9E11)
Applications | CyTOF-ready, ELISA, FC, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Chicken, Yeast |
Conjugation | Unconjugated |
Mouse Monoclonal RNA polymerase II Antibody (4H8)
Applications | ChIP, CyTOF-ready, ELISA, FC, ICC/IF, IP, WB |
Reactivities | Human, Mouse, Yeast |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Yeast, Dog, Chicken, Chimpanzee, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174) |
Mouse monoclonal Hsp60 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Monkey, Pig, Rabbit, Helicobacter pylori, Hamster, Spinach, Salmonella Typhimurium, Trichinella spiralis, Yeast, Escherichia coli, White Fly |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against ABCF2
Applications | ICC/IF, Simple Western, WB |
Reactivities | Human, Yeast |
Conjugation | Unconjugated |
Immunogen | A fusion protein containing amino acids 1-102 of the ABCF2 protein. |
Mouse Monoclonal anti-Hsc70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Sheep, Dog, Bovine, Fish, Rabbit, Chicken, Xenopus, Drosophila, Yeast, Beluga, Hamster, Guinea Pig |
Conjugation | Unconjugated |
PCNA mouse monoclonal antibody, clone PC10, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Insect, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
PCNA mouse monoclonal antibody, clone PC10, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Insect, Mouse, Rat, Yeast |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RHOC Antibody
Applications | IHC, WB |
Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
PCNA mouse monoclonal antibody, clone PC10, Purified
Applications | FC, IHC, IP, WB |
Reactivities | Amphibian, Drosophila, Fish, Mammalian, Yeast |
Conjugation | Unconjugated |