Liver Diseases

View as table Download

DLAT (Myc-DDK-tagged)-Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human dihydrolipoamide S-acetyltransferase (DLAT), 20 µg

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, DLAT (Myc-DDK tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, DLAT (mGFP-tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, DLAT (Myc-DDK tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

Lenti ORF particles, DLAT (mGFP-tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

DLAT (tGFP-tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human dihydrolipoamide S-acetyltransferase (DLAT), 1 mg

Tag C-Myc/DDK
Expression Host HEK293T

Recombinant protein of human dihydrolipoamide S-acetyltransferase (DLAT), 100 µg

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal Anti-DLAT Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DLAT

Lenti ORF clone of Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-DLAT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT. Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR

Lenti ORF clone of Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®