DLAT (Myc-DDK-tagged)-Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DLAT (Myc-DDK-tagged)-Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human dihydrolipoamide S-acetyltransferase (DLAT), 20 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 1,453.00
2 Weeks
Lenti ORF particles, DLAT (Myc-DDK tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,453.00
2 Weeks
Lenti ORF particles, DLAT (mGFP-tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,453.00
5 Weeks
Lenti ORF particles, DLAT (Myc-DDK tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
USD 1,453.00
7 Weeks
Lenti ORF particles, DLAT (mGFP-tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
DLAT (tGFP-tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 9,200.00
6 Weeks
Recombinant protein of human dihydrolipoamide S-acetyltransferase (DLAT), 1 mg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 2,950.00
6 Weeks
Recombinant protein of human dihydrolipoamide S-acetyltransferase (DLAT), 100 µg
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-DLAT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DLAT |
USD 1,203.00
In Stock
Lenti ORF clone of Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-DLAT Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT. Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR |
USD 1,203.00
In Stock
Lenti ORF clone of Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 1,203.00
3 Weeks
Lenti ORF clone of Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,203.00
3 Weeks
Lenti ORF clone of Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |