Mouse Monoclonal AMPK alpha 1 Antibody (2B7)
Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal AMPK alpha 1 Antibody (2B7)
Applications | ELISA, FC, ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
USD 447.00
In Stock
PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
PIK3R4 mouse monoclonal antibody, clone OTI5D1 (formerly 5D1), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse (Predicted: Chicken, Pig, Rat, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646) |
Rabbit Polyclonal antibody to ULK2 (unc-51-like kinase 2 (C. elegans))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 693 and 968 of ULK2 (Uniprot ID#Q8IYT8) |
Anti-PRKAA2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit |
Rabbit Polyclonal Anti-PIK3R4 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PIK3R4 |
AMPK alpha 2 (PRKAA2) (Center)/(Thr172) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 145-173 amino acids from the Central region of human PRKAA2 (Thr172) |
Rabbit Polyclonal ULK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ULK1 antibody was raised against a 16 amino acid peptide near the center of human ULK1 . |
ULK1 rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from Human Unc-51-like kinase 1 (ULK1) |
Rabbit Polyclonal ULK3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ULK3 antibody was raised against a 19 amino acid peptide near the center of human ULK3. |
Rabbit polyclonal APG1 (ULK1) Antibody (Center)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1). |
Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |