Germany
Japan
United Kingdom
China
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Adaptive Immunity
View as table Download
Rabbit Polyclonal Antibody against LC3
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121). |
Rabbit Polyclonal Antibody against Survivin - Astrocyte Marker
| Applications | ChIP, ELISA, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Feline, Dog |
| Conjugation | Unconjugated |
| Immunogen | Full-length recombinant human survivin. |
Rabbit Polyclonal Ki-67/MKI67 Antibody
| Applications | FC, ICC/IF, IHC, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
TA336650 is a possible alternative to TA336566.
Rabbit Polyclonal Antibody against DRP1
| Applications | FC, IHC, IP |
| Reactivities | Human, Primate, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region within residues 500-600 of the human protein. [Swiss-Prot# O00429] |
Rabbit Polyclonal Antibody against ATG5
| Applications | Electron Microscopy, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
TOM20 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOM20 (NP_055580.1). |
| Modifications | Unmodified |
Rabbit Polyclonal Antibody against APE1
| Applications | Block/Neutralize, ChIP, FC, ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Affinity purified human Apurinic/Apyrimidinic Endonuclease (APE/ref-1) fusion protein. |
Rabbit Polyclonal Antibody against MAT2 alpha
| Applications | ICC/IF, IHC, IP, Simple Western, WB |
| Reactivities | Human, Rat, Bovine, Zebrafish, Monkey, Orang-Utan (Does not react with: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N terminal portion of the human protein (within residues 1-100). [Swiss-Prot# P31153] |
CTCF Rabbit polyclonal Antibody
| Applications | ChIP, ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human CTCF (NP_006556.1). |
| Modifications | Unmodified |
Rabbit Polyclonal antibody to Fatty Acid Synthase (fatty acid synthase)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 7 and 287 of Fatty Acid Synthase (Uniprot ID#P49327) |
Rabbit Polyclonal anti-HSPA9 antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Acetyl-Histone H3-K18 Rabbit polyclonal Antibody
| Applications | ChIP, ChIP-seq, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic acetylated peptide corresponding to residues surrounding K18 of human H3 |
| Modifications | Acetyl K18 |
mTOR Rabbit polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human mTOR (NP_004949.1). |
| Modifications | Unmodified |
Active filters
Reactivities
- Rat
Applications
- IP
Antibody Hosts
- Rabbit
Filter by
Category
Target Symbol
- H3FT (18)
- H3FA (10)
- STAT1 (7)
- BAX (5)
- CREB1 (5)
- EIF4E (5)
- HISTONE H3 (5)
- TP53 (5)
- AKT1 (4)
- CYCS (4)
- DIABLO (4)
- EGFR (4)
- GSK3B (4)
- MAPK1 (4)
- MAPK8 (4)
- NF2 (4)
- PDHA1 (4)
- STAT3 (4)
- CASP3 (3)
- CBX3 (3)
- CCND1 (3)
- COL2A1 (3)
- CTCF (3)
- EIF4EBP1 (3)
- ENO1 (3)
- FBL (3)
- GRIA2 (3)
- H2AX (3)
- H2BC12 (3)
- H2BC3 (3)
- HIST3H3 (3)
- LDHA (3)
- LEF1 (3)
- MAP2K1 (3)
- MCM5 (3)
- MCM7 (3)
- PTK2 (3)
- RPS6KA1 (3)
- S100B (3)
- SMAD2 (3)
- SQSTM1 (3)
- STIP1 (3)
- VCAM1 (3)
- VCP (3)
- ACLY (2)
- ACSL4 (2)
- ACTA1 (2)
- ACTN2 (2)
- ALCAM (2)
- ATF5 (2)
- ATG5 (2)
- ATP5F1B (2)
- BAD (2)
- BCL2L1 (2)
- BECN1 (2)
- CDC37 (2)
- CDK1 (2)
- CDK2 (2)
- CDK4 (2)
- CKB (2)
- COX5B (2)
- CTNNA1 (2)
- CTNNB1 (2)
- CTTN (2)
- DDAH1 (2)
- DDB1 (2)
- DDX5 (2)
- DGCR8 (2)
- DNMT1 (2)
- EIF3H (2)
- EIF4A1 (2)
- ENO2 (2)
- FADD (2)
- FAM160B2 (2)
- FLOT1 (2)
- FLT1 (2)
- FSCN1 (2)
- FUBP1 (2)
- GRB2 (2)
- GYS1 (2)
- H4C14 (2)
- HIF1AN (2)
- HISTONE H2B (2)
- HPRT1 (2)
- HSPA8 (2)
- IGF2BP3 (2)
- ILF3 (2)
- IRF1 (2)
- JUN (2)
- JUNB (2)
- KDM1A (2)
- LAMIN B1 (2)
- LGALS1 (2)
- MAP1LC3A (2)
- MAP2K3 (2)
- MAP3K2 (2)
- MKL1 (2)
- MTOR (2)
- MYC (2)
- MYELIN BASIC PROTEIN (2)
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Recombinant
Modifications
- Unmodified (216)
- Phospho S727 (2)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K27 (1)
- Acetyl K5 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- MonoMethyl K36 (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Phospho S15 (1)
- Phospho S157 (1)
- Phospho S22 (1)
- Phospho S240/244 (1)
- Phospho S298 (1)
- Phospho S33 (1)
- Phospho S380 (1)
- Phospho S51 (1)
- Phospho S957 (1)
- Phospho T359 (1)
- Phospho Y15 (1)
- TriMethyl K56 (1)
- pan-tri-Methyl K (1)
Assay Types
Families
- Druggable Genome (78)
- Transcription Factors (27)
- Stem cell - Pluripotency (17)
- Transmembrane (14)
- ES Cell Differentiation/IPS (9)
- Protease (6)
- Protein Kinase (5)
- Adult stem cells (2)
- Phosphatase (2)
- Secreted Protein (2)
- Cancer stem cells (1)
- Embryonic stem cells (1)
- Induced pluripotent stem cells (1)
- Nuclear Hormone Receptor (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
Pathways
- Systemic lupus erythematosus (31)
- Pathways in cancer (17)
- Metabolic pathways (15)
- Cell cycle (9)
- Apoptosis (8)
- Huntington's disease (7)
- DNA replication (6)
- Insulin signaling pathway (6)
- Small cell lung cancer (6)
- Adipocytokine signaling pathway (5)
- Chronic myeloid leukemia (5)
- Glycolysis / Gluconeogenesis (5)
- MAPK signaling pathway (5)
- RIG-I-like receptor signaling pathway (5)
- Toll-like receptor signaling pathway (5)
- Colorectal cancer (4)
- Cysteine and methionine metabolism (4)
- Endocytosis (4)
- Focal adhesion (4)
- Prostate cancer (4)
- Proteasome (4)
- Purine metabolism (4)
- Pyrimidine metabolism (4)
- RNA degradation (4)
- p53 signaling pathway (4)
- Alzheimer's disease (3)
- Amyotrophic lateral sclerosis (ALS) (3)
- Chemokine signaling pathway (3)
- Neurotrophin signaling pathway (3)
- Pancreatic cancer (3)
- Pyruvate metabolism (3)
- Renal cell carcinoma (3)
- mTOR signaling pathway (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Butanoate metabolism (2)
- Citrate cycle (TCA cycle) (2)
- Dilated cardiomyopathy (2)
- Endometrial cancer (2)
- Fatty acid metabolism (2)
- Gap junction (2)
- Glutathione metabolism (2)
- Hematopoietic cell lineage (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Mismatch repair (2)
- Non-small cell lung cancer (2)
- Notch signaling pathway (2)
- Nucleotide excision repair (2)
- Oocyte meiosis (2)
- PPAR signaling pathway (2)
- Propanoate metabolism (2)
- Regulation of actin cytoskeleton (2)
- Regulation of autophagy (2)
- Selenoamino acid metabolism (2)
- Spliceosome (2)
- T cell receptor signaling pathway (2)
- Tight junction (2)
- Valine (2)
- Vascular smooth muscle contraction (2)
- Vibrio cholerae infection (2)
- Acute myeloid leukemia (1)
- Adherens junction (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Axon guidance (1)
- B cell receptor signaling pathway (1)
- Basal cell carcinoma (1)
- Base excision repair (1)
- Biosynthesis of unsaturated fatty acids (1)
- Bladder cancer (1)
- Calcium signaling pathway (1)
- Cell adhesion molecules (CAMs) (1)
- Cytosolic DNA-sensing pathway (1)
- ECM-receptor interaction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- ErbB signaling pathway (1)
- Fatty acid biosynthesis (1)
- Fatty acid elongation in mitochondria (1)
- Fc gamma R-mediated phagocytosis (1)
- Fructose and mannose metabolism (1)
- Galactose metabolism (1)
- Glioma (1)
- Glycine (1)
- GnRH signaling pathway (1)
- Homologous recombination (1)
- Jak-STAT signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Limonene and pinene degradation (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysine degradation (1)
- Melanogenesis (1)
- Melanoma (1)
- NOD-like receptor signaling pathway (1)
- Non-homologous end-joining (1)
- Primary immunodeficiency (1)
- Prion diseases (1)
- Progesterone-mediated oocyte maturation (1)
- RNA polymerase (1)
- Starch and sucrose metabolism (1)
- TGF-beta signaling pathway (1)
- Taste transduction (1)
- Thyroid cancer (1)
- Tryptophan metabolism (1)
- Type II diabetes mellitus (1)
- Ubiquitin mediated proteolysis (1)
- Wnt signaling pathway (1)
- beta-Alanine metabolism (1)
- leucine and isoleucine biosynthesis (1)
- leucine and isoleucine degradation (1)
- serine and threonine metabolism (1)