Dendritic Cells

cDNA Clones (16)
Proteins (7)
Antibodies (3)
Jump to Filters
View as table Download
LIGHT (TNFSF14) (NM_003807) Human Tagged ORF Clone
RC217759

USD 300.00

In Stock

TNFSF14 (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LIGHT (TNFSF14) (NM_003807) Human Tagged ORF Clone Lentiviral Particle
RC217759L1V

USD 850.00

2 Weeks

Lenti ORF particles, TNFSF14 (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

LIGHT (TNFSF14) (NM_003807) Human Tagged ORF Clone Lentiviral Particle
RC217759L2V

USD 850.00

7 Weeks

Lenti ORF particles, TNFSF14 (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

LIGHT (TNFSF14) (NM_003807) Human Tagged ORF Clone Lentiviral Particle
RC217759L3V

USD 850.00

5 Weeks

Lenti ORF particles, TNFSF14 (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

LIGHT (TNFSF14) (NM_003807) Human Tagged ORF Clone Lentiviral Particle
RC217759L4V

USD 850.00

2 Weeks

Lenti ORF particles, TNFSF14 (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

LIGHT (TNFSF14) (NM_003807) Human Tagged ORF Clone
RG217759

USD 500.00

In Stock

TNFSF14 (tGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein
TP317759

USD 867.00

In Stock

Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, 20 µg

Tag C-Myc/DDK
Expression Host HEK293T
LIGHT (TNFSF14) (NM_172014) Human Tagged ORF Clone
RG220370

USD 530.00

In Stock

TNFSF14 (tGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein
TP317759L

USD 9,200.00

6 Weeks

Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, 1 mg

Tag C-Myc/DDK
Expression Host HEK293T
LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein
TP317759M

USD 2,950.00

6 Weeks

Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, 100 µg

Tag C-Myc/DDK
Expression Host HEK293T
LIGHT (TNFSF14) (NM_172014) Human Tagged ORF Clone
RC220370

USD 330.00

3 Weeks

TNFSF14 (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LIGHT (TNFSF14) Rabbit Polyclonal Antibody
TA330337

USD 539.00

In Stock

Rabbit Polyclonal Anti-TNFSF14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM
LIGHT (TNFSF14) (NM_003807) Human Tagged Lenti ORF Clone
RC217759L1

USD 600.00

In Stock

Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
LIGHT (TNFSF14) (NM_003807) Human Tagged Lenti ORF Clone
RC217759L4

USD 600.00

In Stock

Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LIGHT (TNFSF14) Goat Polyclonal Antibody
TA305766

USD 520.00

2 Weeks

Goat Anti-LIGHT / CD258 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HEVNPAAHLTGANS, from the internal region of the protein sequence according to NP_003798.2; NP_742011.1.