LIGHT (TNFSF14) (NM_003807) Human Recombinant Protein
CAT#: TP317759
Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217759 representing NM_003807
Red=Cloning site Green=Tags(s) MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVT RLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGY YYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLE AGEKVVVRVLDERLVRLRDGTRSYFGAFMV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003798 |
Locus ID | 8740 |
UniProt ID | O43557 |
Cytogenetics | 19p13.3 |
Refseq Size | 1491 |
Refseq ORF | 720 |
Synonyms | CD258; HVEML; LIGHT; LTg |
Summary | The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418409 | TNFSF14 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY418409 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 14 (TNFSF14), transcript variant 1 |
USD 436.00 |
|
PH317759 | TNFSF14 MS Standard C13 and N15-labeled recombinant protein (NP_003798) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review