Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Dog |
Conjugation | Unconjugated |
Mouse monoclonal anti-ACTB(beta Actin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Dog |
Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against LC3B
Applications | Electron Microscopy, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the N-terminal region of the human LC3, isoform B protein. |
Goat Polyclonal Anti-beta-Actin Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human beta-Actin produced in E. coli. |
Rabbit Polyclonal Antibody against LC3
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human LC3 protein sequence (between residues 25-121). |
Rabbit Polyclonal Antibody against LC3
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, SDS-PAGE, Simple Western, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human LC3 protein sequence (between residues 1-100). |
Goat Polyclonal Anti-TUBA4A Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 400 aa to the C-terminus of human alpha tubulin produced in E. coli. |
Rabbit Polyclonal Anti-TUBA4A Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TUBA4A antibody: synthetic peptide directed towards the middle region of human TUBA4A. Synthetic peptide located within the following region: YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE |
Goat Polyclonal Anti-TUBA4A Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 400 aa to the C-terminus of human alpha tubulin produced in E. coli. |
Rabbit polyclonal anti-iNOS antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human iNOS. |
Rabbit polyclonal LC3 Antibody (APG8B) (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Rat (Predicted: Bovine) |
Conjugation | Unconjugated |
Immunogen | This LC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human LC3. |
Rabbit Polyclonal Anti-ACTB Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)
Applications | IF, IHC, WB |
Reactivities | Human, Drosophila, Rat, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
Applications | Dot, WB |
Reactivities | Human (Predicted: Mouse, Rat, Drosophila) |
Conjugation | Unconjugated |
Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
Modifications | Phospho-specific |
Rabbit Polyclonal Beta-actin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | b-actin antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human b-actin. |
Rabbit polyclonal ENOA Antibody (N-term)
Applications | FC, IF, WB |
Reactivities | Human, Mouse (Predicted: Bovine, Monkey) |
Conjugation | Unconjugated |
Immunogen | This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA. |