beta Actin (ACTB) Rabbit Polyclonal Antibody

CAT#: TA345667

Rabbit Polyclonal Anti-ACTB Antibody

Product Images

Host: Rabbit; Target Name: ACTB; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.ACTB is strongly supported by BioGPS gene expression data to be expressed in HepG2

• 

  1. The sample 1 - 8 is used N2 wild type C. elegans.; 2. Each lane contain 60 ug of sample and the loading volume is 36 ul.; 3. The number 1 sample is a control without any treatment.; 4. As I get 50 ug of primary Ab, I diluted with 50 ul of water. I use 5 ul each time in 10 ml of 5% milk in PBST buffer.; 5. The secondary antibody for chemiluminescence is Peroxidase-AffiniPure Goat Anti-Rabbit IgG (H+L) (111-035-003) from Jacksonimmunoresearch.

• 

  Sample type: 1-8.N2 WT C elegans (60ug)Primary Dilution: 1: 2000Secondary Antibody: goat anti-Rabbit HRPSecondary Dilution: 1: 2000

• 

  WB Suggested Anti-ACTB Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1: 62500 Positive Control: Transfected 293T

• 

  Host: Rabbit; Target Name: ACTB; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: ACTB; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml.ACTB is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Host: Rabbit; Target Name: ACTB; Sample Tissue: MCF7; Antibody Dilution: 1.0 ug/ml.ACTB is strongly supported by BioGPS gene expression data to be expressed in MCF7 cells

• Sample Type: Human brain stem cells Primary Antibody Dilution: 1: 500; Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody: ilution: 1: 1000; Color/Signal Descriptions: ACTB: Red DAPI: Blue; Gene Name: ACTB; Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science

• IHC Information: Paraffin embedded breast tissue, tested with an antibody dilution of 5 ug/ml.

Show all 9 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Mouse, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: actin, beta
• Database Link:
  NP_001092
  Entrez Gene 11461 MouseEntrez Gene 60 Human
  UniProt ID P60709
• Background: This protein is one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, and integrity. This actin is a major constituent of the contractile apparatus and one of the two nonmuscle cytoskeletal actins.
• Synonyms: BRWS1; PS1TP5BP1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Zebrafish: 100%

Reference Data

• Protein Families: ES Cell Differentiation/IPS
• Protein Pathways: Adherens junction, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton, Tight junction, Vibrio cholerae infection, Viral myocarditis