Pro-B cell

cDNA Clones (14)
Antibodies (2)
Proteins (2)
Jump to Filters
View as table Download
CACNA2D1 (NM_000722) Human Tagged ORF Clone
RC219081

USD 1,424.00

In Stock

CACNA2D1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CACNA2D1 (NM_000722) Human Tagged ORF Clone Lentiviral Particle
RC219081L1V

USD 1,974.00

2 Weeks

Lenti ORF particles, CACNA2D1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CACNA2D1 (NM_000722) Human Tagged ORF Clone Lentiviral Particle
RC219081L2V

USD 1,974.00

7 Weeks

Lenti ORF particles, CACNA2D1 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CACNA2D1 (NM_000722) Human Tagged ORF Clone Lentiviral Particle
RC219081L3V

USD 1,974.00

7 Weeks

Lenti ORF particles, CACNA2D1 (Myc-DDK tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CACNA2D1 (NM_000722) Human Tagged ORF Clone
RG219081

USD 1,624.00

In Stock

CACNA2D1 (tGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA2D1 (NM_001302890) Human Tagged ORF Clone
RC237361

USD 330.00

2 Weeks

CACNA2D1 (myc-DDK-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA2D1 (NM_001302890) Human Tagged ORF Clone
RG237361

USD 530.00

2 Weeks

CACNA2D1 (tGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CACNA2D1 (NM_000722) Human Tagged Lenti ORF Clone
RC219081L1

USD 1,724.00

In Stock

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CACNA2D1 (NM_000722) Human Tagged Lenti ORF Clone
RC219081L4

USD 1,724.00

In Stock

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D1 Rabbit Polyclonal Antibody
TA338373

USD 539.00

5 Days

Rabbit Polyclonal Anti-CACNA2D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA2D1 antibody: synthetic peptide directed towards the middle region of human CACNA2D1. Synthetic peptide located within the following region: PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
CACNA2D1 (NM_000722) Human Over-expression Lysate
LY424551

USD 665.00

In Stock

Transient overexpression lysate of calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1)

Tag C-Myc/DDK
Expression Host HEK293T
CACNA2D1 (NM_000722) Human Tagged Lenti ORF Clone
RC219081L2

USD 1,724.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CACNA2D1 (NM_000722) Human Tagged Lenti ORF Clone
RC219081L3

USD 1,724.00

3 Weeks

Lenti ORF clone of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CACNA2D1 (NM_000722) Human Tagged ORF Clone Lentiviral Particle
RC219081L4V

USD 1,974.00

2 Weeks

Lenti ORF particles, CACNA2D1 (mGFP-tagged) - Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

CACNA2D1 (NM_000722) Human Recombinant Protein
TP762298

USD 249.00

In Stock

Purified recombinant protein of Human calcium channel, voltage-dependent, alpha 2/delta subunit 1 (CACNA2D1), Asp253-Leu430, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli