Pro-B cell

cDNA Clones (7)
Antibodies (6)
Proteins (5)
Jump to Filters
View as table Download
A1BG (NM_130786) Human Tagged ORF Clone
RC221406

USD 457.00

In Stock

A1BG (Myc-DDK-tagged)-Human alpha-1-B glycoprotein (A1BG)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
A1BG (NM_130786) Human Tagged ORF Clone Lentiviral Particle
RC221406L3V

USD 1,007.00

7 Weeks

Lenti ORF particles, A1BG (Myc-DDK tagged) - Human alpha-1-B glycoprotein (A1BG), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

A1BG (NM_130786) Human Tagged ORF Clone Lentiviral Particle
RC221406L4V

USD 1,007.00

7 Weeks

Lenti ORF particles, A1BG (mGFP-tagged) - Human alpha-1-B glycoprotein (A1BG), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50

A1BG (NM_130786) Human Recombinant Protein
TP321406

USD 867.00

In Stock

Recombinant protein of human alpha-1-B glycoprotein (A1BG), 20 µg

Tag C-Myc/DDK
Expression Host HEK293T
A1BG (NM_130786) Human Recombinant Protein
TP321406L

USD 9,200.00

6 Weeks

Recombinant protein of human alpha-1-B glycoprotein (A1BG), 1 mg

Tag C-Myc/DDK
Expression Host HEK293T
A1BG (NM_130786) Human Recombinant Protein
TP321406M

USD 2,950.00

6 Weeks

Recombinant protein of human alpha-1-B glycoprotein (A1BG), 100 µg

Tag C-Myc/DDK
Expression Host HEK293T
A1BG (NM_130786) Human Tagged ORF Clone
RG221406

USD 657.00

3 Weeks

A1BG (tGFP-tagged) - Human alpha-1-B glycoprotein (A1BG)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A1BG Rabbit Polyclonal Antibody
TA334283

USD 485.00

5 Days

Rabbit Polyclonal Anti-A1BG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A1BG antibody: synthetic peptide directed towards the N terminal of human A1BG. Synthetic peptide located within the following region: ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG
A1BG (NM_130786) Human Tagged Lenti ORF Clone
RC221406L3

USD 757.00

3 Weeks

Lenti ORF clone of Human alpha-1-B glycoprotein (A1BG), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1BG (NM_130786) Human Tagged Lenti ORF Clone
RC221406L4

USD 757.00

3 Weeks

Lenti ORF clone of Human alpha-1-B glycoprotein (A1BG), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1BG Rabbit Polyclonal Antibody
TA322089

USD 380.00

In Stock

Anti-A1BG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 150-164 amino acids of human alpha-1-B glycoprotein
A1BG Rabbit Polyclonal Antibody
TA322090

USD 380.00

In Stock

Anti-A1BG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 150-164 amino acids of human alpha-1-B glycoprotein
TA322090 is a possible alternative to TA322089.
A1BG (NM_130786) Human Over-expression Lysate
LY408945

USD 665.00

In Stock

Transient overexpression lysate of alpha-1-B glycoprotein (A1BG)

Tag C-Myc/DDK
Expression Host HEK293T
A1BG (Center) Rabbit Polyclonal Antibody
AP50004PU-N

USD 580.00

2 Weeks

A1BG (Center) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 232~262 amino acids from the Central region of human A1BG.
A1BG Rabbit Polyclonal Antibody
TA313407

USD 380.00

4 Weeks

Rabbit polyclonal anti-A1BG antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human A1BG.