Germany
Japan
United Kingdom
China
Alzheimer’s Disease
View as table Download
Rabbit Polyclonal Anti-BACE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY |
Rabbit Polyclonal antibody to beta Amyloid (amyloid beta (A4) precursor protein)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Dog, Pig, Chimpanzee, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 602 and 770 of beta Amyloid (Uniprot ID#P05067) |
Rabbit polyclonal Amyloid β A4 (Phospho-Thr743/668) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Amyloid β A4 around the phosphorylation site of threonine 743 (A-V-TP-P-E) |
| Modifications | Phospho-specific |
Anti-BACE1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human beta-site APP-cleaving enzyme 1 |
TA324168 is a possible alternative to TA349256.
Rabbit Polyclonal Anti-PSEN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSEN2 antibody: synthetic peptide directed towards the N terminal of human PSEN2. Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV |
Rabbit Polyclonal Antibody against APP
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Rat, Pig, Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This APP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 736-770 amino acids from the C-terminal region of human APP. |
Rabbit Polyclonal Amyloid beta A4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Amyloid beta A4 |
Rabbit Polyclonal Amyloid beta A4 (Thr743/668) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Amyloid beta A4 around the phosphorylation site of Threonine 743/668 |
| Modifications | Phospho-specific |
APP Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | N term -peptide of human APP |
Active filters
Applications
- WB
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- Alzheimer's disease