Germany
Japan
United Kingdom
China
Calca goat polyclonal antibody, Purified
| Applications | ELISA, IF, IHC |
| Reactivities | Mouse, Reptiles, Rat, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic Rat Tyr-CGRP (23-37) conjugated to gamma Globulin |
Antibodies
View as table Download
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Pig, Bovine, Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559) |
USD 515.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Monkey, Gibbon, Orang-Utan (Predicted: Mouse, Rat, Bovine, Dog, Hamster, Horse, Pig, Rabbit, Sheep, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Rabbit Polyclonal antibody to beta Actin (actin, beta)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Dog, Rabbit, Chicken, Sheep, Chimpanzee, Bovine, Guinea Pig, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
CCKAR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Gibbon (Predicted: Monkey, Bovine, Rabbit, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CCKAR / CCK1R antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human CCKAR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Rabbit, Guinea pig (94%); Mouse, Elephant, Panda, Bat (88%); Rat, Dog, Horse, Opossum (81%). |
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Guinea Pig, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rat, Rabbit, Guinea Pig, Rhesus Monkey, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 293 and 387 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1) |
TM9SF3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chimpanzee, Chicken, Dog, Xenopus, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Horse, Orang-Utan, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | TM9SF3 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Xenopus (100%); Lizard, Stickleback, Medaka (93%); Bat, Salmon, Zebrafish, Eye worm, Tick (87%); Pufferfish, Drosophila, Water flea, Nematode (80%). |
Rabbit anti Actin, skeletal muscle Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Rabbit, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human alpha skeletal muscle isoforms of actin. This sequence is identical in human, rat, mouse, dog, bovine, guinea pig, sheep and frog origins. |
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Galago, Elephant, Platypus, Medaka (94%); Opossum, Turkey, Zebra finch, Chicken, Stickleback, Pufferfish (89%); Xenopus, Zebrafish (83%). |
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Dog, Xenopus, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Horse, Orang-Utan, Guinea Pig (Predicted: Hamster) |
| Conjugation | Unconjugated |
| Immunogen | GLG1 / MG160 antibody was raised against synthetic 19 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Guinea pig, Turkey, Zebra finch, Chicken, Lizard, Xenopus (100%); Hamster (95%); Stickleback, Medaka, Pufferfish, Zebrafish (84%). |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Guinea Pig
Isotypes
- IgG
Conjugates
- Unconjugated
Filter by
Target Symbol
- GFAP (3)
- GLG1 (2)
- HRH3 (2)
- HSP70-1A (2)
- ACTIN (1)
- AE2 (1)
- ALPHA 1A ADRENERGIC RECEPTOR (1)
- BETA ACTIN (1)
- CALCA (1)
- CCKAR (1)
- CRLR (1)
- DCXR (1)
- DECORIN (1)
- DOPA DECARBOXYLASE (1)
- EAAT1 (1)
- FAM86A (1)
- GIRK1 (1)
- GIRK2 (1)
- GJA1 (1)
- GPX4 (1)
- KCNH2 (1)
- MUSCARINIC ACETYLCHOLINE RECEPTOR M3 (1)
- NEUROPEPTIDE Y (1)
- NQO1 (1)
- PCK2 (1)
- PPARG (1)
- PTBP1 (1)
- RAMP1 (1)
- RBPMS (1)
- RHOC (1)
- TM9SF3 (1)
- VEGFA (1)
- WNT7A (1)
Antibody Hosts
Clonalities
Assay Types
Families
Pathways
- Neuroactive ligand-receptor interaction (6)
- Calcium signaling pathway (3)
- Metabolic pathways (3)
- Vascular smooth muscle contraction (3)
- Adipocytokine signaling pathway (2)
- Antigen processing and presentation (2)
- Cell adhesion molecules (CAMs) (2)
- Endocytosis (2)
- Focal adhesion (2)
- MAPK signaling pathway (2)
- Pathways in cancer (2)
- Prion diseases (2)
- Regulation of actin cytoskeleton (2)
- Spliceosome (2)
- Adherens junction (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Basal cell carcinoma (1)
- Bladder cancer (1)
- Citrate cycle (TCA cycle) (1)
- Cytokine-cytokine receptor interaction (1)
- Dilated cardiomyopathy (1)
- Glycolysis / Gluconeogenesis (1)
- Hedgehog signaling pathway (1)
- Histidine metabolism (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Insulin signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Melanogenesis (1)
- PPAR signaling pathway (1)
- Pancreatic cancer (1)
- Pathogenic Escherichia coli infection (1)
- Pentose and glucuronate interconversions (1)
- Phenylalanine metabolism (1)
- Pyruvate metabolism (1)
- Renal cell carcinoma (1)
- TGF-beta signaling pathway (1)
- Tight junction (1)
- Tryptophan metabolism (1)
- Tyrosine metabolism (1)
- VEGF signaling pathway (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)
- Wnt signaling pathway (1)
- mTOR signaling pathway (1)